KEGG   Weissella koreensis: WKK_06150
Entry
WKK_06150         CDS       T01577                                 

Definition
(GenBank) excinuclease ABC subunit B
  KO
K03702  excinuclease ABC subunit B
Organism
wko  Weissella koreensis
Pathway
wko03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:wko00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    WKK_06150
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:wko03400]
    WKK_06150
DNA repair and recombination proteins [BR:wko03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     WKK_06150
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      WKK_06150
SSDB
Motif
Pfam: UvrB_inter UvrB Helicase_C ResIII UVR AAA_30 AAA_19 DEAD AAA AAA_5 AAA_25 AAA_7 Kinesin AAA_16
Other DBs
NCBI-ProteinID: AEJ24100
UniProt: F8HYK6
LinkDB
Position
1294835..1296850
AA seq 671 aa
MITRQADRKYEVVSKYQPTGDQPKAIDKLVKGLANGVKEQILLGATGTGKTFTISEVIAH
ANKPVLVLSHNKTLAGQLYGEFKEFFPNNAVEYFVSYYDYYQPEAYVPSSDTYIEKDSSI
NDEIDKLRNSATSSLLSRNDTIVVASVSSIFGLGDPYQYRDHVISIRVGDELERNTLMRD
LIDIQFQRNDIDFQRGRFRARGDVVEIFPASSDAKALRIEFFGDEVDRIREIDSLTGEIV
ADLDTITIFPATHFMTNEKIRERALKTIQAELDEQLKNLEDSGKLLEAQRLKQRTEYDIE
MIREMGFTTGIENYSRHMDGRKPGEPPFTLIDFFPDDFLIVVDESHVTMPQIRGMYNGDR
ARKQTLVDFGFRLPSALDNRPLKLQEFEEHVNQVIYMSATPGDYENERVPESEVVQQIIR
PTGLLDPTVEVRPVNGQIDDLLGEINERAAKDERVFVTTLTKKMAEDLTDYLEDVGVKVK
YLHSDIKTLERTEIIRDLRLGKFDVLIGINLLREGIDVPEVSLVAILDADKEGFLRNTRS
LIQSMGRAARNENGHVIMYADHETGSMRSAIDETARRRQLQIEYNEEHGIVPHTIIKPVR
DLIAVSHDSDDTSNNEGSFTEVAFRDMARDDQEKMIKNLEEQMRAAAKRMDFEDAASLRD
SVMELKLQLGK
NT seq 2016 nt   +upstreamnt  +downstreamnt
atgattacacgacaagcagatcgtaaatatgaagtagtatcgaagtatcaacccactgga
gatcaacccaaggcgattgataaattagttaaaggactcgccaacggtgttaaagaacaa
atcttattgggggcgacaggaacaggaaaaacattcacgatttctgaagtgattgcccat
gccaataagccagttttagtgctttcacataataaaactttggctggacaattgtatggt
gaattcaaagaattttttccaaataatgccgtagaatattttgtttcttattatgattat
tatcaaccagaagcttatgttccctcatcagatacctatattgaaaaagattcatccatt
aatgatgagattgataaattacgtaattcggctacttcgtcattgctttcacgaaatgat
accattgttgtggcttcggtttcatcaatttttggattaggagatccttatcaatatcgg
gaccatgtgatctcaattcgggtaggggatgaattagagcgaaatacattgatgcgtgac
ttgattgatatccaatttcaacgcaatgatattgatttccaacgtggacgttttcgggct
cgaggggatgtagtcgaaattttccctgcatcttctgatgcgaaagctttacgtattgaa
ttttttggagatgaagttgatcgaattcgggaaatagatagcttaaccggagaaattgtg
gctgatttagatacaatcaccattttccctgcaactcattttatgacgaatgagaaaatt
cgagaaagagccttgaaaactattcaagccgagttggacgagcaattaaaaaatctagaa
gactctggtaaattgttagaagcacagcgattaaagcaacggactgaatatgatattgaa
atgattcgagaaatgggctttaccacaggaattgaaaattattcaagacatatggatgga
agaaaacctggtgaaccaccatttactttaattgatttttttccagatgattttttaatt
gttgtagatgaatcgcacgttacgatgccccagattcgaggaatgtataatggtgacagg
gctcgtaagcaaacgttggttgattttggattccggctaccatcagctcttgataatcgt
ccattgaagttgcaagagtttgaagagcatgtcaatcaagtcatctatatgtcagcaaca
ccaggtgactatgaaaatgaacgagtaccagaatcagaggttgttcaacaaattattaga
ccaacagggttacttgatccaacagtggaagttcgtcctgtaaatggacaaattgatgat
ttattgggtgaaattaatgagcgcgcagctaaagatgaacgggtctttgtaacaacattg
actaagaagatggctgaagatttaactgattatttggaagatgtgggagtgaaagttaaa
tacttacattctgatattaagacgttagaacgtactgaaataattcgtgatttaagatta
ggtaagtttgatgtgttgattggaattaatttgttacgagagggtattgatgtccctgaa
gtttcattagtggcaattttagacgcagacaaagaagggtttcttagaaatacccgttcg
ttaattcaaagtatgggacgagctgcccgaaatgaaaatggacacgtaattatgtatgcg
gatcatgagactggttcaatgcgatcagcaattgatgaaacggcccgaaggcgtcaatta
caaattgaatataatgaggaacacgggatagttcctcatacgattattaaacccgttcgt
gatttgattgccgtatcacatgattcagatgatacttctaataatgagggatcattcaca
gaagtggcgttccgtgatatggctcgtgatgatcaggagaagatgattaaaaatttggaa
gagcaaatgcgagctgctgctaaacgcatggatttcgaagatgctgctagtttgcgtgat
tcagtaatggagttaaaattgcaacttggtaaatga

DBGET integrated database retrieval system