KEGG   Weissella koreensis: WKK_06500
Entry
WKK_06500         CDS       T01577                                 

Gene name
murC
Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
wko  Weissella koreensis
Pathway
wko00471  D-Glutamine and D-glutamate metabolism
wko00550  Peptidoglycan biosynthesis
wko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wko00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    WKK_06500 (murC)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    WKK_06500 (murC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:wko01011]
    WKK_06500 (murC)
Enzymes [BR:wko01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     WKK_06500 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:wko01011]
 Precursor biosynthesis
  Amino acid ligase
   WKK_06500 (murC)
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase DUF1829
Other DBs
NCBI-ProteinID: AEJ24170
UniProt: F8HZG3
LinkDB
Position
1372139..1373479
AA seq 446 aa
MDKQKLYYFIGIKGSGMSSLALILHDQGYEVSGSDIDQYTFTQKPLAAAGIPMYSFDAQN
IKPGMIVIRGNAFDDQQVEVAAALKLGSEVEMLTYPELVQTLIGQYTSVGVAGAHGKTST
TGLLAHVLSGIAPTSYLIGDGTGKGVPDARFFAFEADEYRRHFKDYTPDYAIMTNIDFDH
PDYYRDIDDVFDAFNDFSHNVKKAIFAWGDDVKLRELETDVPVYYYGLNDKDDFIAKNIK
RSTKGSSFDAYYHDELLGNFQVPLFGIHGILNSLSVIAVAYVEEIDLDLLQQELLSFKGV
KRRFTEKTVGDVTIIDDYAHHPSEIKATLDAARQKFPGRELVAVFQPHTFSRTIAYLDEF
AESLDLADRVYLTDIFASARETQGNISSADLGAKMTKFGGIISPDDVAPLMQHDQNPVVV
FMGAGDVQQTEFAYEKILSNLTSNLQ
NT seq 1341 nt   +upstreamnt  +downstreamnt
atggacaaacagaaattatattattttattggaattaaaggatcaggaatgagttcgcta
gcgttaattctgcacgatcaaggctatgaagtgtctggatcagatattgatcaatatact
tttactcaaaagccgcttgctgctgctggcattccgatgtattcatttgatgctcaaaat
attaagccaggaatgattgtgatccgaggaaatgcttttgatgatcaacaagtggaagta
gcagcagctttgaaattaggttcagaagttgaaatgctaacttatcctgaattagttcag
accttgattggtcaatacacttcagttggtgttgctggggcccatggtaaaacatcaaca
accggtcttttagctcatgttttgtcagggattgctccaacttcatatttgattggtgat
ggaacgggaaaaggggttccagatgctcgtttcttcgcctttgaagctgacgaatatcgt
cgtcatttcaaggattacacccctgattatgctattatgacgaatattgactttgatcat
cctgattattatcgagatattgatgatgtatttgatgctttcaatgattttagtcataat
gttaagaaggcaatctttgcttggggtgatgatgttaaattacgtgaattggaaacggat
gtcccagtttactactacggtttgaatgataaagatgattttattgctaaaaatatcaaa
cgttcaactaagggatcaagttttgatgcttattatcatgatgaattacttggtaatttc
caagttccgctctttggaatacatggaattttaaactcattgtcagttatcgctgtggca
tacgttgaagaaatcgatcttgatttgttgcagcaagagttattgagctttaaaggagta
aaacgccgctttactgaaaagacagtgggtgatgttacgattattgatgattatgcgcat
catccttctgaaattaaagcaactttggatgcggcccgacaaaaatttcctggtcgtgaa
ctagttgctgtcttccaaccacacactttttcaagaacgatcgcctatttagatgaattt
gcggaatcattagatctcgctgatcgtgtctatttgacagatatttttgcctcagctcgc
gagacgcaaggtaatatttcttcagctgaccttggggctaagatgacaaagtttggagga
attatctcacctgatgatgtagcgccattaatgcaacatgatcagaatccagtggtcgta
tttatgggggctggagatgtacaacaaactgaatttgcatatgaaaaaattctctcaaat
cttacatcaaacctacagtag

DBGET integrated database retrieval system