KEGG   Wenzhouxiangella marina: WM2015_1977Help
Entry
WM2015_1977       CDS       T04011                                 

Definition
(GenBank) Malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
wma  Wenzhouxiangella marina
Pathway
wma00020  Citrate cycle (TCA cycle)
wma00270  Cysteine and methionine metabolism
wma00620  Pyruvate metabolism
wma00630  Glyoxylate and dicarboxylate metabolism
wma00680  Methane metabolism
wma01100  Metabolic pathways
wma01110  Biosynthesis of secondary metabolites
wma01120  Microbial metabolism in diverse environments
wma01130  Biosynthesis of antibiotics
wma01200  Carbon metabolism
Module
wma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
wma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
wma_M00012  Glyoxylate cycle
wma_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:wma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WM2015_1977
   00620 Pyruvate metabolism
    WM2015_1977
   00630 Glyoxylate and dicarboxylate metabolism
    WM2015_1977
  09102 Energy metabolism
   00680 Methane metabolism
    WM2015_1977
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    WM2015_1977
Enzymes [BR:wma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     WM2015_1977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N RCDG1
Motif
Other DBs
NCBI-ProteinID: AKS42343
UniProt: A0A0K0XXD3
LinkDB All DBs
Position
2355289..2356272
Genome map
AA seq 327 aa AA seqDB search
MNRPKRVAITGAAGQIGYQLCFRIASGDLLGPNQPVILQLIEIAPALDALKGVVMELEDA
AFPLLAGVEATADLETGFKDADYAILVGAKPRGPGMERADLLSENGKIFGPQGRALNAVA
SRDVKVLVVGNPANTNALIAQANAPDLPKENFTAMTRLDHNRALAQLAARTGIHHTSIRQ
MTIWGNHSSTQYPDLHHTLVAGKPAMEAEGVDASWYESDFIPTVQQRGAAIIKARGASSA
ASAASAAIDHIRDWALGTDGDDWVSMAVPSDGSYGIEPGVIYSFPCTCENGQWSIVQGLE
INEFSRARMDATDQELREERAAVESLL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtcccaagcgcgttgccatcaccggcgccgccggccagatcggctaccagctc
tgcttccgcatcgcttccggcgatctgctcggccccaaccagccggtcatcctccagctg
atcgaaatcgccccggccctggacgcgctgaagggcgtggtcatggagctcgaagacgcc
gccttcccgctgctcgctggcgtcgaagccaccgccgatctggaaaccggcttcaaggac
gccgactatgccatcctcgtcggcgccaagccgcgcggtcccggcatggagcgcgctgac
ctgttgagcgaaaacggcaagatcttcggcccgcagggtcgcgccctgaacgccgtcgcc
agccgtgacgtgaaggtcctggtcgtcggcaacccggccaataccaacgcgctgatcgcc
caggccaatgcaccggacctgccgaaagagaacttcacggcgatgacccgcctggaccac
aatcgcgccctggcgcagctcgcagcccgcaccggcatccaccacaccagcattcgtcag
atgaccatctggggtaaccacagctcgacccagtacccggatctgcatcacaccctggtg
gccggcaagccggcgatggaggccgaaggcgtggatgcgagctggtacgagtccgatttc
attccgaccgtgcagcagcgcggcgcggcgatcatcaaggcacgtggggcctccagcgcc
gcctcggcggcgtctgccgccatcgaccacatccgcgactgggccctgggcaccgacggc
gatgactgggtctcgatggccgtcccttcggacggtagctacggcatcgagccgggcgtg
atctattccttcccctgcacctgcgagaacggccagtggtcgatcgtccagggtctggag
atcaacgagttctcgagggcgcggatggatgccaccgaccaggaactgcgcgaagagcgc
gccgcggtcgagagcctgctctag

DBGET integrated database retrieval system