KEGG   Wenzhouxiangella marina: WM2015_822Help
Entry
WM2015_822        CDS       T04011                                 

Definition
(GenBank) hypothetical protein
Organism
wma  Wenzhouxiangella marina
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_8 LRR_4 fn3 LRRNT_2
Motif
Other DBs
NCBI-ProteinID: AKS41203
UniProt: A0A0K0XU56
LinkDB All DBs
Position
953402..955345
Genome map
AA seq 647 aa AA seqDB search
MSGLKQIAPCFPSREIRASMLGLVCWLLAALPGVGQAQIPANERQALLDLYAQTNGPDWI
EDSGWGGPPGSECGWFGVTCLNGQVGDLRLAANGLSGSLPVSIGDLDGLLFLWLSFNDLG
GPLPSSLGNLARLQYLYLDGNAFSGGIPASLGQLGALQWLLLHDNQLSGPIPSGLGSLSE
LRVLRLYDNQLSGSLPPGLASLTSIEEIDLSGNALTGALPSSLPGWGQLRLLDLSDNALT
GPLPAAIAELVRLERLAIQRNQLKGPLPEGLGGLAALRELYLDGNLIGGGLPAEIVELSQ
LEILSLGDNPLGGELPSTIGQMSALREIYLGDAELAGSIPSSLGQLDELERLYLFSNQLE
GPLPAAFNQLSGLVEINLAGNQLSGALPGGLSGLVQLERLWLEGNRFSGPFPAAVAEFQA
LSSLRLQFNCFSGPLPDGPGQWAALVELDVRVNCLTGELPTGLGEAASLETLRLSANDFS
GSIPSEWLALDSIIALDLYDNRLDTDDPTLIAWLDALNPSWARWQTRPPEDLSVAAVDAT
SVTLSWTPIDYPLQQAGYYHVSAESDPSLFADRFESALPVPPLDASFQAASTDYSASALS
LVDLVPDTVYRVVVRSITPARVDPVFPQQNTLISRPTAVLQFTTPAQ
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggtctgaaacagattgcaccttgctttccgtcgagagagatcagggcgtcgatg
ctcggtctggtctgctggcttctcgccgcactgccgggagttggccaggcgcagatcccg
gccaacgagcgccaggccttgctcgatctctatgcgcagaccaacggacccgactggatt
gaggattcgggctggggcggtccgccgggcagcgaatgcggctggttcggcgtcacctgc
ctgaatggacaggtgggcgatcttcggctggcggccaacggtctgagcggcagcctgccg
gtcagcatcggtgatctcgatggcctgcttttcctctggttgtccttcaacgatctcggc
gggcccttgccgagcagtctgggtaatctcgcacgattgcagtatctctatctcgacggc
aacgccttctccggcggcattccggcgtcgctgggtcaactcggagcgctgcagtggctt
ctgctgcacgacaaccagctcagtggtccgatcccgtcgggcctgggcagcctttccgaa
ctgcgagtgctcaggctctacgacaatcagctcagcggatccctgccgccgggcctcgcc
tcgctgacctcgatcgaggaaatcgacctgagcggcaacgcgctgaccggggcacttcct
tcgtccttgccgggttggggccagctccgccttctcgacctcagcgacaacgcattgacc
gggccgctgccggcagccattgccgaactcgtccggctggaacggcttgcgattcagcgc
aatcagctgaaggggccgttgccggagggtctcggcgggctggcagcattgcgagagctt
tatctggatggcaatctcatcggtggcgggttgcccgccgagatcgtcgagttgagtcag
ctcgaaatcctttccctgggtgataatccgctcggtggggaactgccttccaccatcggt
cagatgtcggccctgcgggagatctacctcggagacgccgagctggccgggtcgatccca
tcgagcctcgggcagctcgacgagctcgagcgcctgtacctgttttccaatcagctcgaa
ggtccgctgcccgccgccttcaatcaactttccggtctggtggaaatcaacctggcgggc
aatcagctcagcggtgccctgcccggtgggctgagcgggctggtgcaactcgagcgactc
tggctggagggcaatcgcttcagcggaccgtttcccgcagccgtggcggaatttcaggcc
ttgagcagcctgcgtctgcagttcaactgtttcagtggcccgctgcccgacgggccgggt
cagtgggccgcactggtcgaactggatgttcgcgtcaattgcctgacaggcgaactgccg
accggtctgggcgaggcggcctcgctggagacgctccgtttgagtgcgaatgacttcagc
ggttcgattccgagcgagtggctggccctcgactcgatcatcgctctggacctctacgat
aatcgtctcgacaccgatgatccgaccttgatcgcctggctggatgcgctgaatccgagc
tgggcgcgctggcagacacggccgcccgaagatctttcggtggctgccgtcgatgccacg
agcgtcacgctgagctggacgccgatcgattatccgctgcagcaggccgggtactatcac
gtcagcgcggagtccgacccgtcgctgttcgccgaccgattcgaatcggccttaccggtc
ccgcccttggacgcatcctttcaggcggcgagcacggactattcagcgagcgccttgtcc
ctggtcgatctggtcccggacacggtctatcgggtcgtggttcgatcgatcaccccggcg
cgagtcgatccggtcttcccgcagcagaataccctgatcagccgtccgacggccgtgctg
caattcaccacgcccgcacaatga

DBGET integrated database retrieval system