KEGG   Woeseia oceani: BA177_01545Help
Entry
BA177_01545       CDS       T04427                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
woc  Woeseia oceani
Pathway
woc00473  D-Alanine metabolism
woc00550  Peptidoglycan biosynthesis
woc01100  Metabolic pathways
woc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:woc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BA177_01545
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BA177_01545
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BA177_01545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:woc01011]
    BA177_01545
Enzymes [BR:woc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BA177_01545
Peptidoglycan biosynthesis and degradation proteins [BR:woc01011]
 Precursor biosynthesis
  Amino acid ligase
   BA177_01545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C RimK ATP-grasp_4 ATPgrasp_ST ATP-grasp_3 CPSase_L_D2 ATPgrasp_Ter TTL ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ANO50078
UniProt: A0A193LC83
LinkDB All DBs
Position
complement(334396..335433)
Genome map
AA seq 345 aa AA seqDB search
MKHYRILLLVHEDLIPPKDIDGLSELQIDVFRSEYNVYSTLYNLGHDVRIVGILDHLAEL
RNTVREWQPHVVFNMLDEFHGIPAYEQYVVAYLEMIRQRYTGCNPRGLLLSRDKVLTKQV
LAAHRIATPAFHLFPYGARFRTPRKGKLKFPLFVKSATDDASLGISQASIVEDMNSLRER
VAYIHEKVQSDALVEEYIEGRELYVGVLGNKRLTTLPVWEMDFGTLAGKRGGIATRRVKW
DRKYQKKHGIQTGPAPGLSKADEDKLTRLAKRIYRALHMCGFARLDLRMREDGKVFLLEA
NANPDLTQGEDLAESAASIGINYDKLISRIVNLGLSYMPEWRLYE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacactaccgcatcttgctgttggtgcatgaggacctgattccaccgaaagacatc
gacggactcagcgagttgcagatcgatgtgttccgcagcgagtacaacgtctactcgacg
ctgtacaacctcggccacgacgtccgcattgtcggcatcctcgatcaccttgcggaattg
cgcaacacggtgcgtgagtggcagccgcatgtcgtgtttaacatgctcgatgaatttcac
ggtatcccggcttacgagcagtatgtcgtcgcctacctggagatgattcgtcagcgttat
accggctgcaatccgcgcggcctgttgctgtcgcgggacaaggtgttgacgaaacaggta
ctggccgcgcaccggatcgcaacgccggcgtttcacctttttccgtacggggcgcggttc
aggacgccgagaaaaggcaaactgaagtttccgctgttcgtgaaatcggcgaccgacgat
gcatcgctgggcatatcacaggcgtccatcgtcgaagacatgaacagccttcgcgaacgc
gtggcatatattcatgagaaagtgcaaagcgatgcgctggtggaagaatacatcgagggg
cgcgaactgtacgttggcgtactgggcaacaagcggctgacaaccttgccggtttgggaa
atggacttcggcacacttgccggcaagcgcggcggtatcgcaacgcgcagagtcaagtgg
gaccgcaagtaccagaaaaagcacggcatccaaaccgggcctgcgccaggtttatcgaaa
gcggatgaagacaaactgacacggctcgcaaaacgcatttaccgcgcgttgcacatgtgc
ggcttcgcccgcctggatctacgtatgcgggaagacggcaaggttttcctgctcgaggcc
aacgcgaacccggacctcacgcaaggcgaggacctggcagagtcagcagcatcgataggc
atcaactacgacaaactgatttcccgcatcgtcaaccttggcctgtcctacatgccagag
tggcgcctgtacgaatag

DBGET integrated database retrieval system