KEGG   Woeseia oceani: BA177_04330Help
Entry
BA177_04330       CDS       T04427                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
woc  Woeseia oceani
Pathway
woc00380  Tryptophan metabolism
woc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:woc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BA177_04330
Enzymes [BR:woc01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     BA177_04330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ANO50544
UniProt: A0A193LDT4
LinkDB All DBs
Position
1012895..1014172
Genome map
AA seq 425 aa AA seqDB search
MQYQSSLEFAKAQDQKDPLRTYRDRFHFPSLGTAELAYFTGHSLGLQPKSVRAAVSLELD
EWAKYGVEGHFHSTNPWYSYHERLTPAMAEIVGAKDSEVVCMNSLTTNIHLLFVSFYRPT
ASRYKIISEAKMFPSDRYMLETQVRFHGFDPDDAIIEVPPRAGESLIREEDILAAIESNA
DELAMVFFGGVNYLTGQLFDMQSLTKAAHAVGAIAGFDLAHAAGNVLLSLHEWDVDFAAW
CSYKYLNSSPGNVGAIFVHERHGRNFDLPRFGGWWGHDKTTRFQMKNDFQPMEGADGWQL
SNAPILGMSAAKASLDVFAEVGMAALRKKSEMLTGYLEYTVGLLADEFPDAEISVITPRD
PDQRGCQLSIDIAGRERQLFDDMIAAGVIADFREPCIIRVAPVPLYNSFEDVFTFGKIMR
KLLPK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatcagtcaagcttggagttcgcgaaagcgcaggatcaaaaagatccgttaaga
acgtatcgtgaccgtttccacttcccgtcacttggtaccgccgaactggcatatttcacc
ggccattcgctcgggcttcagccgaagtcggttcgtgctgcagttagcctggaacttgat
gaatgggcaaagtacggtgtggaagggcattttcattcaacgaatccctggtacagctac
catgagcgcttgacgccggctatggcagaaattgtcggcgcaaaagactccgaagttgtc
tgcatgaactctctgacgaccaatattcatctgttgttcgtgtcgttctatcggccaacg
gcgtcgcgctataagatcataagcgaggcgaaaatgtttccttccgatcgatacatgctg
gaaacgcaagttcgctttcacggatttgacccggatgatgccatcattgaggtgccaccg
agggcaggtgagagcctgattcgggaagaagacattctcgctgctattgaatctaatgcg
gatgagttagcgatggtgttcttcggtggcgtcaactatttaacgggacagttgttcgac
atgcagagcttgaccaaggcggcgcatgcagttggcgccattgccgggttcgatctcgcc
catgcggcgggaaacgtgcttttgtcactacacgaatgggatgttgacttcgcggcctgg
tgttcctacaagtacttgaattcgagtccgggcaatgttggggcgatattcgttcacgaa
cggcatggtcggaattttgacctgccacgtttcggtggctggtgggggcacgacaagacg
acccgctttcagatgaagaacgattttcaaccgatggagggcgcggatggctggcaactg
agtaatgcaccgattctcggtatgtccgcggcgaaagcgtccctcgatgtatttgccgaa
gttgggatggccgcattaagaaagaagagcgaaatgctcacaggctacctcgaatacacg
gtgggcctgctggcagatgaatttccggatgcagaaatcagtgtcataacgccgcgtgat
ccagatcaacgtggctgtcagctatcaatcgatattgccggacgcgagcgccagctattt
gatgacatgattgccgctggcgtcatcgccgattttcgcgagccctgcatcattcgggta
gcacccgtaccgctctacaattcgtttgaagacgttttcacgttcggcaaaataatgcgt
aagctactgccaaagtga

DBGET integrated database retrieval system