KEGG   Woeseia oceani: BA177_04635Help
Entry
BA177_04635       CDS       T04427                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
woc  Woeseia oceani
Pathway
woc00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:woc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BA177_04635
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:woc02000]
    BA177_04635
Enzymes [BR:woc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BA177_04635
Transporters [BR:woc02000]
 Other Transporters
  Pores ion channels [TC:1]
   BA177_04635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C Tom37 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ANO50593
UniProt: A0A193LDN7
LinkDB All DBs
Position
complement(1094536..1095153)
Genome map
AA seq 205 aa AA seqDB search
MTQDIVLYTNPMSRGRIARWMLEEVAAPYRTVILEYGADMKSPEYLAVNPMGKVPALQHG
SAIITECAAICAYLADAFPDSGLAPPLTERAAYYRWLFFVAGPLESALNNKALGVEVPVE
RERMVGYGKLATVVDTLEAAVQERPFIAGDTFSAADVYVGSHVGWGLQFGTLDKRPAFED
YWSRISGRDALQRANALDDVDPPAG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgacccaggatatcgtgctgtacacaaacccaatgtcccgcggaagaatcgcgcgatgg
atgctcgaggaggttgctgctccctaccgaactgtgatccttgagtacggtgctgatatg
aagtcgcccgaatacctcgccgtaaacccgatgggcaaagtcccggcattgcagcacggc
tctgcgatcatcacggagtgtgcggccatttgcgcctacctcgccgacgcgtttccggac
tcaggactggcaccgcccctgaccgaacgcgccgcgtactatcgttggctgttctttgtt
gccgggccgctggaatctgcgttaaacaacaaggctttgggagtggaagtgcccgttgaa
cgggagcgcatggttggctacggcaagttggcgacagtggtcgacacacttgaagccgcg
gtccaggaacggccgttcatcgcgggcgatacgttttctgctgccgacgtgtacgtcggc
tcgcatgttggctggggattgcaattcggcaccctcgataagcgacccgccttcgaggat
tactggtccaggataagtggtcgcgacgcactgcagcgcgccaatgccctggatgatgtg
gacccgcccgccgggtaa

DBGET integrated database retrieval system