KEGG   Woeseia oceani: BA177_17915Help
Entry
BA177_17915       CDS       T04427                                 

Definition
(GenBank) hypothetical protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
woc  Woeseia oceani
Pathway
woc00550  Peptidoglycan biosynthesis
woc01100  Metabolic pathways
woc01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:woc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BA177_17915
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BA177_17915
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:woc01003]
    BA177_17915
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:woc01011]
    BA177_17915
Enzymes [BR:woc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BA177_17915
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BA177_17915
Glycosyltransferases [BR:woc01003]
 Polysaccharide
  Bacterial polysaccharide
   BA177_17915
Peptidoglycan biosynthesis and degradation proteins [BR:woc01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BA177_17915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: ANO52813
UniProt: A0A193LK55
LinkDB All DBs
Position
3991842..3994556
Genome map
AA seq 904 aa AA seqDB search
MPKPAKQSANTTARRPRWRRWLVLLTGLSLCGTLGIAAGIIGAWFYVVPGLPAAETIRDI
PLQIPLRIFSRDGRLIEEVGERRRIIVTFDELPPHVVNAFVAAEDSRFFSHPGVDPIGIG
RALVNYVRSGSRGQGGSTITQQLARDYFLTRERLFSRKLREAFLAWKIEQEFSKQEIMAL
FVNKMFFGQRAYGVAAAAQVYFGKPLSNISVSEAAILAGVLPAPSFYNPVRSAGNARIRR
DYVLGRMLDLGFVDQSEYRVAMEEPVMSQLHGTATELSAPYVAEMVRREMLERYGEDTYS
AGYRVVTTLDSRMQNSATYALKNGLLEFTRRRGYRGPIDRIDFDPALHERPFTEWPEETQ
LALDGYSKPGGLLVALVTRLRDDNGADIVLEDGSRNVLPWHGISWARPYIDGQSRGPVPT
SVGQVLNPGDIVHIMPIQAGGYALAQAPRVQGAIVSLDPKDGAITSLAGGFDFSISKYNR
ANQASRQPGSSFKPFIYSAALEHGNTAATLLLDAPVVINSSELEAVWRPVNYTGRFYGEQ
RMREALVRSMNLASVRLLLNNTGIGNTLRHLEPFGFGPATLIRNGSLALGGGNATPLDMA
QAYAVFANGGYAVKPYVIDGIFGPNNEELYRAAPAVVCERCQPVEEPPAETIADEVDEFA
ELGVPGEPDSIATLDRSEAAVAGDIAETVSPEQVERSQELALLNMVEVAETYRPDASEEP
SLYEGVNLAPRIISAQNAYIVADMMRDVINRGTGRRARVLGRRDLSGKTGTSNDRRDAWF
AGFNGDMSSIVWIGYDNYDPLGPGEEGSRTALPVWIEFAKRALQGAPNNQLPMPEGIVTV
RISKTSGCPADTRVPPSDAMFEIFRVGHVPVCQQAEEQEDIFNQDDAYQFDEELPPSGDV
IFQR
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagcccgctaaacagtctgccaacaccaccgctcgccgccctcgctggcggcgc
tggctggtcctgctgaccggcctcagcctgtgcggaacgcttggcattgccgccggcatc
attggcgcctggttctacgtcgtgccggggctgccggcggccgaaaccatccgggatatc
ccgctgcagatcccgctgcgcatattcagccgtgacggccgcttgattgaggaagtcggc
gaacgccggcgcataatcgtgactttcgacgagctgccgccacacgtggtcaatgccttt
gtcgccgccgaagacagccgctttttcagccaccccggggtagaccccatcggtattggc
cgcgcactggtcaactacgtgcgttccgggtctcgcggccagggcggcagcaccatcacc
cagcagctggcccgcgactattttttgacccgcgaacgcctgttcagccgaaaactgcgc
gaagcattcctggcctggaagatcgagcaggaattcagcaaacaggaaatcatggcgctg
ttcgtgaacaagatgttcttcggccaacgcgcctatggcgtcgcggcggcagcacaggtc
tacttcggcaagccgctcagtaatataagtgtcagcgaggccgcgattcttgccggcgta
ctgcccgcaccgtccttctacaatccggttcgcagcgccggcaatgcgcgaatccgtcgc
gactacgtactcggccgcatgctcgacctcggctttgttgatcaaagcgagtaccgagtg
gcgatggaagaaccggtcatgtcacagctgcacggcacggccaccgagttgtctgcaccg
tatgttgcggaaatggttcggcgggaaatgctcgaacgctacggcgaagacacctactcc
gccggctacagagtcgtgaccacgctcgactcgcggatgcagaacagcgccacgtatgcg
ctgaagaatggcctgctggagtttacccgtcggcgcggttatcgcggcccgatcgaccgc
atcgactttgatcctgcgctgcacgaacggccgtttacagaatggccggaagaaacgcag
ctggcactcgacggttacagcaagccgggtggcttgctggtcgcgctggtgacccgcctg
cgggatgacaacggtgccgacatcgtccttgaggatggctcgcggaacgtgttgccctgg
cacgggatttcctgggcacggccgtacatcgacgggcaaagtcgcggcccggtgccgacc
agtgtcggccaggtactgaaccctggcgatatcgtgcatatcatgccgatccaggccggc
ggttatgcgctggctcaggcgccacgcgtgcagggcgccatagtctcactggacccgaaa
gacggcgcgatcaccagtctcgccggcggcttcgacttctcaatcagcaagtacaaccgc
gccaaccaggcttcgcggcaaccgggctcgtcgttcaagccctttatttattcggcagca
ctggagcacggcaatacggccgcgacgctgttgctggatgcacccgtggttatcaattct
tcggagctcgaagccgtctggcgacccgttaactacacgggacgcttctacggcgaacaa
cgtatgcgcgaagcgctggtgcgctctatgaacctggcctctgtgcggctgttgctgaac
aacacggggatcggcaatacactaaggcacctcgaaccgtttggcttcggtccggccaca
ctgattcgcaacggctcactcgcactcggcggtggcaatgctacgccactggacatggcg
caggcctatgccgtgttcgccaatgggggttatgccgtcaagccgtacgtgattgatgga
attttcgggcccaacaatgaagaactctatcgcgcagcgccggccgtagtctgcgaacgc
tgccagcctgtcgaagagccgcccgcagagacgatcgcggacgaagtcgacgagttcgcc
gaacttggtgtacctggcgagccggatagcattgccacactggaccgttcggaggcggcg
gtcgccggtgacatcgcggagacagtctcgccggaacaggttgagcgcagtcaggagctt
gccctgctgaacatggtggaggtcgccgagacctaccggccggatgccagcgaggagccg
tcgctgtacgagggcgtcaatctcgcaccgcgcatcatcagcgcgcaaaacgcctatatc
gttgccgacatgatgcgcgacgtgatcaatcgcggcaccgggcgccgtgcacgggtactg
ggacgccgagacctttccggcaagaccggtacgtcgaatgatcgccgtgacgcctggttt
gccggctttaacggcgacatgtcatcgatagtctggattggctacgacaattacgaccca
ctgggaccgggcgaagagggttcacggaccgcgctgccggtgtggattgaatttgcgaag
agagcgctgcaaggcgcacccaacaatcagctgccgatgcccgagggcatcgtcaccgtg
cgaatatcgaaaacatccggctgcccggcagatacacgtgtgccgcccagtgacgcgatg
ttcgaaattttccgggtcggacacgtaccggtttgccaacaggcagaagagcaggaagac
atcttcaatcaggatgacgcttaccaattcgacgaagagctgccaccgtccggcgacgtt
attttccagcggtag

DBGET integrated database retrieval system