KEGG   Wolbachia wMel (Drosophila melanogaster): WD_0387Help
Entry
WD_0387           CDS       T00160                                 

Gene name
tkt
Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
wol  Wolbachia wMel (Drosophila melanogaster)
Pathway
wol00030  Pentose phosphate pathway
wol01100  Metabolic pathways
wol01110  Biosynthesis of secondary metabolites
wol01120  Microbial metabolism in diverse environments
wol01130  Biosynthesis of antibiotics
wol01200  Carbon metabolism
wol01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:wol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    WD_0387 (tkt)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    WD_0387 (tkt)
Enzymes [BR:wol01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     WD_0387 (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh TPP_enzyme_C Glyco_tran_WecB
Motif
Other DBs
NCBI-ProteinID: AAS14113
UniProt: Q73HZ9
LinkDB All DBs
Position
complement(369209..371281)
Genome map
AA seq 690 aa AA seqDB search
MNHSHLKSMANAIRFLSIDAVQKANSGHPGMPLGMADVATVLFAKYLNHNPDDSKWFNRD
RFVLSNGHGSMLLYSILYLTGYISVDELKNFRQMGSKTPGHPEFGLTSGVEATTGPLGQG
FAAAVGMALAESILEKQFRINHYTYVMLGDGSLMEGISHEAASLAGHLKLNKLIALFDDN
DISIDGATCLSCSDDVEKRFLAYGWNVDKIDGHDFDAISLAIEQAKKSDKPTMICCKTII
GKFSSRAGTSSAHSGAFSEEDIKQMREKLNWNYEPFHVPEDVKNAWKKTVERAKQNYTMS
FQRVTLESRKEEKEWIPVSSTGMTRESTGMTEENAGMTGYHAELQRRLDKHLPDNIAGVL
ADLKKQICELMPNEATRSSFGRVMELLTESMPELIGGSADLTGSNCTKYEHMQVINSNNY
SGSYVHYGVREHAMAACMNGMALHGAILPYGGTFLVFSDYCRPAIRLSALMKQQVMYVMT
HDSIGVGEDGPTHQPIEHLASLRAIPNLYVFRPADAVETLECVSIALEKKESPALFALSR
QNVSYMRKFYSDIDQSANLSKFGAYILCECSKELKVTIFATGSEVEIAVEAREKLQEKGI
GTRIVSMPCWRLFDEQSDEYKAAILNNDSIKVAIEAGSEMGWHKYIGSNGIFIGMKSFGE
SAPYKTLYEHFNISADHVVKCVCEKLVYIQ
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgaatcattcacatttaaaatctatggcaaacgccatccgttttttatcaattgatgca
gtacaaaaagcaaactctggacacccaggtatgccacttggcatggcagatgttgcaact
gttttgtttgctaaatatctgaatcataatcctgatgattctaaatggttcaatagagat
cgctttgttttatcaaacggtcatgggtcaatgttactatactcaatattatatttgaca
ggttatattagcgtagatgagctaaaaaacttcagacaaatgggatccaagaccccaggt
catccagagttcggcttgacttccggggtagaggcaacaacaggcccgctcggtcagggg
tttgccgctgctgttggcatggcacttgctgaatcgatacttgaaaagcagtttagaatc
aatcactacacttatgtgatgctaggggatggctctcttatggaaggaataagccatgaa
gcagcatcacttgctgggcatcttaaattgaataagcttatagctctttttgatgataat
gatatttctatagatggcgctacttgcctttcctgttctgacgatgtagagaaacgcttc
ttagcgtatggatggaatgttgacaaaattgatggccatgattttgatgccatatccctt
gcaatagagcaagcaaaaaagtctgataaacctacaatgatctgctgcaaaactattatc
ggaaaattttcaagccgtgctggcacatcctctgctcacagtggtgctttttcggaggaa
gacataaaacagatgagagagaaattaaactggaattatgaaccattccatgtaccagaa
gatgtgaaaaatgcctggaagaaaactgttgagagagcaaaacaaaactacacgatgtca
ttccagcgcgtgacgctggaatccaggaaagaagaaaaagaatggatcccagtgtcaagc
actgggatgacaagagagagtactgggatgacagaagagaatgctgggatgacagggtat
catgcagaacttcaaagacggttagataaacatctaccagataatatcgctggtgtttta
gctgacctgaagaaacaaatatgtgagctaatgccaaacgaagctactcgatcttctttc
ggcagagtaatggaacttttaactgagtctatgccggaattaatcggcggttctgctgat
cttaccgggtcaaattgcactaaatatgagcacatgcaggtaataaatagcaataattat
agtggctcttatgtccactatggagtgagagagcacgctatggcagcatgtatgaatggt
atggcacttcacggcgcgattcttccttatggcggcacttttttggtattttccgactat
tgtcgtcctgctatacgtctttcagctctgatgaagcagcaggttatgtatgtcatgact
cacgactcaattggagtgggagaagatggcccgactcatcagccaatagagcatttagcc
tctttgcgtgctataccaaatctatatgtttttaggccagccgatgcagttgaaactctg
gagtgtgttagcattgcactcgaaaagaaagaatctccagcactgtttgcgctctcaagg
caaaacgtaagttacatgcgcaagttctactctgatatcgatcaatctgctaatttatcg
aagtttggtgcatatattttgtgtgaatgttcaaaagaattaaaagtgacgatatttgct
acggggtccgaggttgaaattgcagttgaagcaagggagaaattgcaggaaaagggtata
ggtacaaggattgtttctatgccatgctggaggctttttgacgagcaaagcgatgaatat
aaagcggcaatattaaataatgacagcattaaagttgcaattgaagccggaagtgaaatg
ggttggcataaatatataggttcaaacggtatatttattggcatgaaaagcttcggagaa
tcagcaccttataaaacactctatgagcattttaatatcagcgcagatcatgtggtaaaa
tgtgtgtgtgagaaactggtttacattcagtag

DBGET integrated database retrieval system