KEGG   Wolbachia wMel (Drosophila melanogaster): WD_0437Help
Entry
WD_0437           CDS       T00160                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
wol  Wolbachia wMel (Drosophila melanogaster)
Pathway
wol00020  Citrate cycle (TCA cycle)
wol00190  Oxidative phosphorylation
wol00650  Butanoate metabolism
wol01100  Metabolic pathways
wol01110  Biosynthesis of secondary metabolites
wol01120  Microbial metabolism in diverse environments
wol01130  Biosynthesis of antibiotics
wol01200  Carbon metabolism
Module
wol_M00009  Citrate cycle (TCA cycle, Krebs cycle)
wol_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
wol_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:wol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WD_0437 (sdhA)
   00650 Butanoate metabolism
    WD_0437 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    WD_0437 (sdhA)
Enzymes [BR:wol01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     WD_0437 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     WD_0437 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AAS14160
UniProt: Q73HV3
LinkDB All DBs
Position
418353..420152
Genome map
AA seq 599 aa AA seqDB search
MDKSAYEIIEHEYDVVVVGAGGAGLRATLGMAATNFSVACISKIFPTRSHTVAAQGGISA
ALGNIGEDDWRWHAYDTIKGSDWLGDQDAIEYMCKNAAKAVIELENFGVPFSRTEDGKIY
QRSFGGMTTHFGKGKSAQRTCAAADKTGHAILHTLYQQCLKFNAEFFVEYFVIDLIMDSE
TCCGVLAWSLCDGTLHRFRAHRVVLATGGYGRVYFSATSAHTCTGDGNGMVVRAGLPLED
MEFVQFHPTGIYGSGCLMTEGCRGEGGYLVNSQGEKFMERYAPKAKDLASRDVVSRAITI
EIREGRGVGPKKDHMYLTIAHLDPEVIKLRLPGISETARTFAGVDVTKDPIPVIPTVHYN
MGGIPTNYYGEVITLKQGKEEVVDGLFAIGEAACVSVHGANRLGSNSLLDLVVFGRAAAL
RAKEKLKSGTPHKKLHSDCTDWIVDRFNKMRFASGGLKVAKIRGEMQNTMQKYASVFRVA
EVLEEGKKAIKKVAKMMPDISLEDRSMMWNSDLVEALELANMIPQAVITMECAANREESR
GAHAREDFPERDDKNWMKHTIAWLEEKKGQINVKIDYKKVAEKTLSGEIDFIAPEKRVY
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggataagtcagcgtatgagatcatagaacatgagtatgacgtggtagtagtaggtgca
ggtggagcagggctcagagcaacgcttgggatggctgcaactaatttttcagttgcctgc
atttctaaaattttccctacacgaagtcatacagttgcagcacaaggcggaattagtgca
gctttaggtaatatcggtgaagacgattggcgctggcatgcatatgacacaataaaaggt
tcagactggcttggtgatcaagatgcaatagaatatatgtgtaaaaacgctgctaaagct
gttattgaacttgaaaattttggcgtacctttttctcgtacagaagatggcaaaatatac
cagcgttcctttggtggaatgacaactcactttggtaaaggaaaatcagcgcagcgcact
tgtgcggcagcagataagactgggcacgcaatccttcacactctatatcagcagtgtctt
aaattcaacgctgaattttttgttgaatactttgtgattgatttaattatggatagcgaa
acatgctgcggagttcttgcttggtcgctatgcgacggcacattacatagatttcgtgcg
catagagtggtgctagcaacaggtggatatggacgtgtttatttctctgcaacaagtgcg
catacctgcacaggtgatggtaatggcatggtagtaagggctggattaccacttgaagat
atggaatttgtacaatttcatccaacaggaatatatggctcagggtgcttgatgacagaa
ggatgccgtggtgaaggggggtacctcgttaattctcagggcgagaagtttatggaacgt
tacgcaccaaaagcaaaagatttagcttcccgtgatgtggtaagtcgcgcaataacaatt
gaaattagagagggaaggggggttggaccaaaaaaagatcatatgtatttaactatagcg
catcttgatccggaagtaataaaactcagattgccgggcatcagcgaaaccgcaagaact
tttgctggagttgatgtcactaaagatccaataccggtcattccgactgttcactataac
atgggtggcattccaaccaattattatggagaagtgatcacgctgaagcaaggtaaggaa
gaggtagtagatggactatttgcaattggagaagctgcgtgtgtctctgtgcacggtgca
aatcgacttggctctaactcgcttcttgatcttgtggtttttggtagagctgcagcgctc
agagcaaaagagaagctaaagtccggtacaccacataaaaaattgcattcagactgcaca
gactggatagtagatagatttaataaaatgcgatttgcttccggtgggctaaaagtagca
aaaatacgcggtgaaatgcagaacactatgcaaaaatacgcatcagttttccgtgttgct
gaagttttagaagaaggcaaaaaagctataaaaaaggtagcaaaaatgatgcctgatatt
tcacttgaggatcgcagtatgatgtggaacagtgatttagttgaagcgctggagcttgct
aacatgatcccacaagcggttattaccatggaatgcgcagctaatcgcgaggaaagcaga
ggtgcacatgctcgtgaagactttcctgaacgtgatgacaaaaactggatgaagcacact
atagcgtggcttgaagaaaagaaagggcaaattaacgtaaaaattgattataaaaaagtg
gctgaaaaaactctgagcggtgagattgatttcatagcgccagagaagagggtttattag

DBGET integrated database retrieval system