KEGG   Wolbachia wOo (Onchocerca ochengi): wOo_05140Help
Entry
wOo_05140         CDS       T02212                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
woo  Wolbachia wOo (Onchocerca ochengi)
Pathway
woo00020  Citrate cycle (TCA cycle)
woo00190  Oxidative phosphorylation
woo00650  Butanoate metabolism
woo01100  Metabolic pathways
woo01110  Biosynthesis of secondary metabolites
woo01120  Microbial metabolism in diverse environments
woo01130  Biosynthesis of antibiotics
woo01200  Carbon metabolism
Module
woo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
woo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
woo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:woo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    wOo_05140
   00650 Butanoate metabolism
    wOo_05140
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    wOo_05140
Enzymes [BR:woo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     wOo_05140
    1.3.5.4  fumarate reductase (quinol)
     wOo_05140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 DAO HI0933_like Lycopene_cycl GIDA FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CCF78172
UniProt: I7IHV1
LinkDB All DBs
Position
444459..446264
Genome map
AA seq 601 aa AA seqDB search
MDKLAYAIIEHEYDVVVVGAGGAGLRTALEIAATNFSVACISKIFPTRSHTVAAQGGISA
ALGNIAEDDWRWHAYDTIKGSDWLGDQDAIEYMCKNAAKAVIELENFGVPFSRTEKGTIY
QRSFGGMTTHFGKGKSAQRTCAAADKTGHAILHTLYQQCLKFNVKFFVEYFVIDLIMDNK
TGMCCGVFAWSLCDGTLHKFRAHAVVIATGGYGRIYFSATSAHTCTGDGNGMVVRAGLPL
EDMEFVQFHPTGIYGSGCLMTEGCRGEGGYLINSQGERFMERYASKAKDLASRDVVSRAI
TIEIREGRGVGPKKDHIYLVIAHLDPEVIKLRLPGISETAKAFAGVDVTKDPIPVIPTVH
YNMGGIPTNYHGEVITLKKGKEEIVEGLFAIGEAACISVHGANRLGSNSLLDLIVFGRAA
ALRAKEKLKLNTPHRKLHSDCTDWIVDRFNKMRFASGGLKVAKIRNKMQNTMQRYASIFR
VAEVLEEGKKAIKEVAKMMLDIVIEDRSMIWNSDLVEALELANMVPQAVITMECAANREE
SRGSHAREDFPKRDDKNWMKHTMAWLEEEEGEINVKIDYKKVAEKTLSDEIDFIAPEERI
Y
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggataagttggcgtacgcgattatagagcatgagtatgacgtagtggtagtaggtgca
ggtggagcaggactcagaacagcacttgaaatcgctgccactaatttttcagttgcttgc
atctctaaaatctttcctacgcgcagtcatacagttgcagcgcagggtggaatcagtgca
gctttagggaatattgctgaggacgattggcgctggcatgcgtatgatacaataaaagga
tcagattggcttggtgatcaagatgcaatagaatatatgtgtaaaaacgctgctaaggct
gttattgaacttgaaaattttggtgtgcctttttctcgcacggaaaaaggcacaatatac
cagcgttcttttggagggatgacaactcattttggtaaaggaaaatcagctcagcgtact
tgtgcagcagcagataaaactgggcatgcaattcttcacactctatatcagcagtgtctt
aagttcaatgttaaattttttgttgaatactttgtgattgatttaatcatggacaataaa
accggaatgtgctgtggagtttttgcctggtcactatgtgatggtacactgcataaattt
cgtgcacatgcagtggtgatagcaacaggtggatatgggcgtatttacttttctgcaaca
agtgcacacacctgcacaggtgatggtaatggtatggtagtgagagccgggttgccactt
gaagatatggagtttgtgcaatttcatccaacaggaatatatggctcaggatgcttgatg
acagaaggatgtcgaggagaaggtgggtaccttattaattctcaaggtgagagattcatg
gagcgctacgcttctaaggcaaaggacttagcttctcgcgatgtggtaagtcgtgcaata
acaattgaaattagagagggaagaggagttggaccaaagaaagatcacatatatttagtt
atagcacaccttgatccagaagtaataaaactgaggcttccaggaattagtgaaaccgca
aaggcttttgcaggagttgatgttaccaaagatccaataccggttattccaactgttcac
tataatatgggtggtattccaactaattatcatggagaagtgatcacgttgaaaaaaggt
aaggaagaaatagtagaaggattatttgcaattggagaagcagcatgtatttctgtacac
ggtgcaaatcgacttggttctaactcgcttctcgatcttatagtttttggtagagctgca
gcgctaagagcaaaggaaaaattgaagctcaatacaccacatagaaaattgcactcagat
tgtacagattggatagtagataggttcaataagatgagatttgcttctggagggcttaaa
gtagcgaaaatacgcaataaaatgcagaacactatgcaaagatatgcatctatatttcgt
gttgctgaagttttagaagaaggtaagaaagctataaaagaagtagcaaaaatgatgctt
gatattgtaattgaagatcgcagtatgatatggaacagcgatttagttgaagcactagaa
ctcgctaatatggttccacaagcagttattactatggaatgcgcagctaaccgcgaagaa
agcagaggttctcatgctcgtgaggattttcctaagcgtgatgacaagaattggatgaag
cacactatggcgtggcttgaagaagaggaaggcgaaattaatgtgaaaattgattataaa
aaagttgctgaaaaaactttgagtgatgagattgacttcatagcgccagaagagaggatt
tattaa

DBGET integrated database retrieval system