KEGG   Weissella paramesenteroides: CO680_05010Help
Entry
CO680_05010       CDS       T05120                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
wpa  Weissella paramesenteroides
Pathway
wpa00970  Aminoacyl-tRNA biosynthesis
wpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wpa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CO680_05010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:wpa03029]
    CO680_05010
Enzymes [BR:wpa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CO680_05010
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CO680_05010
Mitochondrial biogenesis [BR:wpa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CO680_05010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase Cast
Motif
Other DBs
NCBI-ProteinID: ATF41453
LinkDB All DBs
Position
complement(993992..995449)
Genome map
AA seq 485 aa AA seqDB search
MNFLHTDIEKLHEQLVNKEITSVDLVKETLANIAQTDAKYDAFLATMSEKALAEAAAIDE
AGIDPDNVLSGIPYGIKDNLITKDVPTTAASKILEDFKPIYDATVVSRLREQGAVGVGKL
NMDEFAMGSTTETSYYKQTKNAWDQTKVPGGSSGGSAVSVAAGQVPFALGTDTGGSIRQP
AAFNGIVGMKPTYGRVSRWGVIAFASSLDQVGVFTRRVKDNATVLAAMAGHDDHDQTSSD
QAVPDFTAHLDGDISGLKIAVPTEYFGAGVDDSIKETIRAGIDQLRELGATVDEVSLPHT
KYGVAAYYILASAEASSNLQRFDGIRYGFRPENVKSLEDLYVQTRTQGFGDEVKRRIMLG
TYSLSAGSYDAFFKKAAQVRTLMNDDFQKVFADYDLIVAPTTPNVAYDFGANQDDPEVTY
MNDVLTIPVNMAGLPGMSVPAGFVDGLPVGMQLIANRYQEETIYRVAYAFEQATRLFEKV
PGGKD
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaattttttgcatacagacattgaaaagttacatgagcaacttgtaaataaagaaatc
acatcagttgacttagtgaaagagacgttagcaaatattgcgcaaactgatgcaaaatat
gatgcattcttagcaactatgtcagaaaaggcattggccgaagctgctgctattgatgaa
gcgggtattgatccagataatgtcttgtcaggtattccttatggtatcaaagataacttg
attaccaaggatgtgccaacaactgccgcatcaaaaattttggaagattttaagccgatt
tatgatgcaactgttgtctcacgtttacgtgaacaaggtgcagtgggcgttggaaagtta
aacatggacgagtttgccatgggatcaacgactgaaacatcatactataagcagaccaag
aacgcttgggaccaaaccaaggtacctggtggttcatcaggtgggtcagcggtctcagtt
gctgctggccaagtaccttttgcactaggaacagatactggtggttcgattcgtcaacca
gcagccttcaacggtatcgttggtatgaagccaacttatggtcgtgtatctcgttggggt
gtgattgcctttgcatcttcacttgatcaagtaggtgtgtttacgcgtcgtgtcaaagat
aatgcgactgtgttagctgcaatggcaggtcatgatgaccatgatcaaacttcttcagat
caagccgttcctgattttacagctcacttggatggtgatatttctggattgaagattgct
gtgccaacagaatactttggcgctggagttgacgatagtatcaaagagaccattcgtgcc
ggcatcgatcaattacgcgaactcggtgcaacggtagatgaagtatcattaccacataca
aagtatggggttgctgcttattatatcttggcttctgctgaagcatcatcaaacttgcaa
cgttttgatggtattcgttatggattccgtccagaaaacgttaaaagcttagaagacttg
tatgtccaaacgcgtacccaaggattcggtgatgaagtgaagcgtcgtattatgcttggt
acttactcactttcagctggttcatacgatgctttctttaagaaagctgcacaagtacga
acattgatgaatgatgatttccaaaaggtctttgcagattatgatttaatcgttgcgcca
acgacaccaaatgttgcttatgactttggtgctaatcaggacgaccctgaagtgacttac
atgaacgatgttttgacgattcctgtcaatatggccggcttaccaggtatgtcagtacca
gctggatttgttgatggcttgccagttggtatgcaattgattgcaaaccgctaccaagag
gaaacgatttaccgtgttgcctatgcatttgagcaagcaacacgtctatttgaaaaagta
ccaggaggtaaggattaa

DBGET integrated database retrieval system