KEGG   Wolbachia pipientis: DEJ70_06370Help
Entry
DEJ70_06370       CDS       T05842                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
wpp  Wolbachia pipientis
Pathway
wpp00550  Peptidoglycan biosynthesis
wpp01100  Metabolic pathways
wpp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:wpp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DEJ70_06370
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DEJ70_06370
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DEJ70_06370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:wpp01011]
    DEJ70_06370
Enzymes [BR:wpp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DEJ70_06370
Peptidoglycan biosynthesis and degradation proteins [BR:wpp01011]
 Precursor biosynthesis
  Amino acid ligase
   DEJ70_06370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: QBB84307
UniProt: A0A411IAD7
LinkDB All DBs
Position
complement(1305687..1306640)
Genome map
AA seq 317 aa AA seqDB search
MLMVPTIAILSGGFSCEREISLMSGKAVKKALDSLLYNAIEIDVDSNISDKLKKTNPDLA
FIALHGPYGEDGCIQGLLEILGIKYTHSGVMPSAVAMNKVMSKHIFHSLNIDTPRGYVIS
REDVLKNNIKVDYPYVLKPINEGSSIGVHMIFSHEDYLKLKDGNSAIMERMIIEEYIPGI
ELHTAVLLNEAIGTMEIRPKNKFYDYEAKYTDGFAEHIFPAEIPDNIYRMTLEHALKVHQ
FLGCKTVSRSDFRYNPQNNTLKMLEINTHPGFTELSLVPEIAKLTKGIDFNELIKIIVKD
SLHHKNIRDQVDVEQCY
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcttatggttccaactatagcaattttaagtggtggattttcttgtgaaagagaaata
tcacttatgagtggaaaagcagtaaagaaggcgcttgatagccttttatataatgcaata
gaaatagatgttgatagcaacatttctgacaagcttaaaaaaactaatcccgatcttgct
tttattgctctacatggaccttatggtgaagatggttgtattcaaggtttattagaaatc
ttaggtataaaatatacacactctggagttatgccttcagctgttgctatgaataaagtg
atgtcaaagcatatattccattctcttaatatcgacactccaagaggttatgtaattagt
cgagaagatgtgctaaaaaataatattaaagttgattatccgtacgtcttaaaaccgatt
aacgaaggctcaagcattggagtacacatgattttctcacatgaggattacctgaaacta
aaagatggcaattctgccattatggaaagaatgatcatagaagaatacataccgggtata
gagttacatactgctgtgttactgaatgaagcaattggcactatggaaatacgaccgaaa
aataaattctatgattatgaagcaaagtatacagatggatttgcagaacatatatttcct
gctgaaattcctgacaacatatatagaatgaccttggaacacgcactaaaagttcatcaa
tttttaggatgcaaaactgtttcccgctcagacttccgttataatccccaaaataacact
ttaaaaatgcttgagattaatacacatcctggctttactgaattatcgttagtaccagaa
attgcaaaattgacaaaaggaattgattttaatgaattaattaaaattattgtcaaagac
agtttacaccacaagaatattagagatcaagtcgatgttgaacaatgttactag

DBGET integrated database retrieval system