KEGG   Wolbachia wRi (Drosophila simulans): WRi_003080Help
Entry
WRi_003080        CDS       T00866                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
wri  Wolbachia wRi (Drosophila simulans)
Pathway
wri00020  Citrate cycle (TCA cycle)
wri00190  Oxidative phosphorylation
wri00650  Butanoate metabolism
wri01100  Metabolic pathways
wri01110  Biosynthesis of secondary metabolites
wri01120  Microbial metabolism in diverse environments
wri01130  Biosynthesis of antibiotics
wri01200  Carbon metabolism
Module
wri_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:wri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WRi_003080 (sdhA)
   00650 Butanoate metabolism
    WRi_003080 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    WRi_003080 (sdhA)
Enzymes [BR:wri01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     WRi_003080 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     WRi_003080 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: ACN95126
UniProt: C0R5T4
LinkDB All DBs
Position
complement(329416..331215)
Genome map
AA seq 599 aa AA seqDB search
MDKSAYEIIEHEYDVVVVGAGGAGLRATLGMAATNFSVACISKIFPTRSHTVAAQGGISA
ALGNIGEDDWRWHAYDTIKGSDWLGDQDAIEYMCKNAAKAVIELENFGVPFSRTEDGKIY
QRSFGGMTTHFGKGKSAQRTCAAADKTGHAILHTLYQQCLKFNAEFFVEYFVIDLIMDSE
TCCGVLAWSLCDGTLHRFRAHRVVLATGGYGRVYFSATSAHTCTGDGNGMVVRAGLPLED
MEFVQFHPTGIYGSGCLMTEGCRGEGGYLVNSQGEKFMERYAPKAKDLASRDVVSRAITI
EIREGRGVGPKKDYMYLTIAHLDPEVIKLRLPGISETARTFAGVDVTKDPIPVIPTVHYN
MGGIPTNYYGEVITLKQGKEEVVDGLFAIGEAACVSVHGANRLGSNSLLDLVVFGRAAAL
RAKEKLKSGTPHKKLHSDCTDWIVDRFNKMRFASGGLKVAKIRSEMQNTMQKYASVFRVA
EVLEEGKKAIKKVAKMMPDISLEDHSMMWNSDLVEALELANMIPQAVITMECAANREESR
GAHAREDFPERDDKNWMKHTIAWLEEKKGQINVKIDYKKVAEKTLSGEIDFIAPEKRVY
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggataagtcagcgtatgagatcatagaacatgagtatgacgtggtagtagtaggtgca
ggtggagcagggctcagagcaacgcttgggatggctgcaactaatttttcagttgcctgc
atttctaaaattttccctacacgaagtcatacagttgcagcacaaggcggaattagtgca
gctttaggtaatatcggtgaagacgattggcgctggcatgcatatgacacaataaaaggt
tcagactggcttggtgatcaagatgcaatagaatatatgtgtaaaaacgctgctaaagct
gttattgaacttgaaaattttggcgtacctttttctcgtacagaagatggcaaaatatac
cagcgctcttttggtggaatgacaactcactttggtaaaggaaaatcagcgcagcgcact
tgtgcggcagcagataaaactgggcacgcaatccttcacactctatatcagcagtgtctt
aaattcaacgctgaattttttgttgaatactttgtgattgatttaattatggatagcgaa
acatgctgcggagttcttgcttggtcgctatgcgacggcacattacatagatttcgcgcg
catagggtggtgctagcaacaggtggatatggacgtgtttatttctctgcaacaagtgcg
catacctgcacaggtgatggtaacggcatggtagtaagggctggattaccacttgaagat
atggaatttgtacaatttcatccaacaggaatatatggctcagggtgcttgatgacagaa
ggatgccgtggcgaagggggatatctcgttaattctcagggcgaaaagtttatggaacgt
tacgcaccaaaagcaaaagatttagcttcccgtgatgtggtaagtcgtgcaataacaatt
gaaattagagagggaaggggagttgggccgaaaaaagattacatgtatttaactatagcg
catcttgatccggaagtaataaaactcagattgccgggcattagcgaaaccgcaagaact
tttgctggagttgatgtcactaaagatccaataccggtcattccgactgttcactataac
atgggtggcattccaaccaattattatggagaagtgatcacgctgaagcaaggtaaggaa
gaagtggtagatggactatttgcaattggagaagctgcgtgtgtctctgtgcacggtgca
aatcgacttggctctaactcgcttcttgatcttgtggtttttggtagagctgcagcgctc
agagcaaaagagaagctaaaatccggtacaccacataaaaaattgcattcagactgcaca
gactggatagtagataggtttaataaaatgcgatttgcctccggtgggctaaaagtagca
aaaatacgcagcgaaatgcagaacactatgcaaaagtacgcatcagtgttccgtgttgct
gaagttttagaagaaggcaaaaaagctataaaaaaggtagcaaaaatgatgcctgatatt
tcacttgaggatcacagtatgatgtggaatagtgatttagttgaagcactggagcttgct
aacatgatcccacaagcggttattaccatggaatgcgcagctaatcgcgaggaaagcaga
ggtgcccatgctcgtgaagactttcctgaacgtgatgacaaaaactggatgaagcacact
atagcgtggcttgaagaaaagaaagggcaaattaacgtaaaaattgattataaaaaagtg
gctgaaaaaactctgagcggtgagattgatttcatagcgccagagaagagggtttactag

DBGET integrated database retrieval system