KEGG   Wallemia mellicola: WALSEDRAFT_20618Help
Entry
WALSEDRAFT_20618  CDS       T03142                                 

Definition
(RefSeq) succinate dehydrogenase and fumarate r
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
wse  Wallemia mellicola
Pathway
wse00020  Citrate cycle (TCA cycle)
wse00190  Oxidative phosphorylation
wse01100  Metabolic pathways
wse01110  Biosynthesis of secondary metabolites
wse01130  Biosynthesis of antibiotics
wse01200  Carbon metabolism
Module
wse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
wse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
wse_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:wse00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WALSEDRAFT_20618
  Energy metabolism
   00190 Oxidative phosphorylation
    WALSEDRAFT_20618
Enzymes [BR:wse01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     WALSEDRAFT_20618
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7
Motif
Other DBs
NCBI-GeneID: 18470845
NCBI-ProteinID: XP_006959523
JGI: Walse1_20618
UniProt: I4Y955
LinkDB All DBs
Position
Unknown
AA seq 255 aa AA seqDB search
MRSFSTSTRRALATPVGAKPPHMKKFQIYRWNPDKPAEKPRMQTYDVDLNACGPMVLDAL
LKIKNEADPTLTFRRSCREGICGSCAMNIEGQNTLACLCRIDRNENKASKIYPLPHMYIV
KDLVPDMTQFYKQYKSIEPYLQSDNVPDGVEHRQSPEERKKLDGMYECILCACCSTSCPS
YWWNQDEYLGPAVLMQAYRWIADSRDSKAAERKEKLENTFSLYRCHTIFNCTRTCPKGLN
PAKAIAEMKKEMATA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaggtccttttctacttcaactagacgtgcattagcaaccccagttggtgctaagcca
ccacacatgaagaagttccagatttacagatggaacccagacaagcctgctgagaagcca
cgcatgcaaacctacgatgttgacctcaacgcttgtggaccaatggtactcgacgcctta
cttaaaattaagaatgaagccgaccctacgctcaccttcagaaggtcctgtagagagggt
atctgtgggtcatgtgcaatgaacatcgaaggtcagaatacactcgcttgtctttgtaga
atagacagaaatgagaacaaagctagcaagatttacccacttccacacatgtacattgtc
aaagatttagttccagatatgacacaattctacaagcaatacaagtccattgagccatac
ttgcaatcagacaacgtcccagatggcgtcgaacaccgtcaatcacctgaagagagaaag
aagcttgacggtatgtacgaatgtatcctctgcgcttgttgctccacttcctgtccatct
tactggtggaaccaagacgaatacctcggtccagcagtactcatgcaagcatacagatgg
atcgctgattctagagactcaaaggcagctgaacgtaaggaaaaactcgagaacactttc
agtttatacagatgtcacactattttcaactgcacacgtacctgtccaaagggtttgaat
ccagccaaggctattgctgagatgaagaaggagatggcaaccgcatag

DBGET integrated database retrieval system