KEGG   Wallemia mellicola: WALSEDRAFT_22107Help
Entry
WALSEDRAFT_22107  CDS       T03142                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
wse  Wallemia mellicola
Pathway
wse00020  Citrate cycle (TCA cycle)
wse00310  Lysine degradation
wse00380  Tryptophan metabolism
wse01100  Metabolic pathways
wse01110  Biosynthesis of secondary metabolites
wse01130  Biosynthesis of antibiotics
wse01200  Carbon metabolism
Module
wse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
wse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:wse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WALSEDRAFT_22107
  09105 Amino acid metabolism
   00310 Lysine degradation
    WALSEDRAFT_22107
   00380 Tryptophan metabolism
    WALSEDRAFT_22107
Enzymes [BR:wse01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     WALSEDRAFT_22107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 18470911
NCBI-ProteinID: XP_006960395
JGI: Walse1_22107
UniProt: I4Y6K5
LinkDB All DBs
Position
Unknown
AA seq 1006 aa AA seqDB search
MLRRSLFNSRLCSRRLLSTSIRVSQDTLKQPPAPFDAFSTTGLDHAFLESAYGEWRKDNN
SVHPSFATYFEALENGVDPAEAFVPPPKLAGALADSAASPKHTDLGDHLKAQLLVRAYQV
RGHHLASLDPLNLTQTDVNNMVPPELKIDSYGWSERDLDRQISLGPGILPRFAIDGRNKM
SLREIIQTCEQIYCGPIGIQYIHIPDKDQCDWLRKRVEIPHPWRYNIEEKSNILDRLLWS
TCWEQFIAAKFPNEKRFGLEGAESLIPGMKALIDRAVDHGTKHITIGMPHRGRLNVLSNV
IRKPSEAIFNEFTGANDDTQSGGGDVKYHLGANYTRPTPSGKKVNLSLVANPSHLEAENP
IVLGKTRALQHIEGDEGKGDSSLGLLLHGDGAFAAQGIVYETLGMVNLPNYGTGGTIHVV
VNNQVAFTTDPEDSRSTAYPTDIAKSIDAPIFHCNGDNAEAVTFVFQLAADFRAKFKKDV
VINLVCYRKHGHNESDQPSFTQPIMYEAIAKQPTALAKYVKQLQQEEAFTETQMEEHRKA
VWSKLESAFKNAPNYKPHGREWLSSSWEGFPSPDDLAARVLPTATTGVKQETLENIGKVI
STFPDGFTPHKNLARIIGNRGKMVMEGKGIDWSTAEALAFGSLALEKIHVRLSGQDVERG
TFSQRHAILVDQQNESLYMPLNHLGSRQAGVVVCNSSLSEFGTLGYELGYSLVSPDNLTL
WEAQFGDFANNAQCIIDQFIASGERKWLQRSGLVMSLPHGYDGQGPEHSSGRIERFLQLA
DDNPFSVPTEEEMARQHQDCNIQVVYPTTPANYFHVLRRQVHRDFRKPLILFFSKALLRH
PMARSTLEEMTGETQFERYIPENSEKMVEPEKVRKHILCSGQVYHTLYKEREERQAYDVA
ISRLEQISPFPYDLIQSHLDKYPNAEITWCQEEPLNNGAWSYVSQRLLTLVKQTKHHSER
WPQYVGRDPSSSVATGSKAVHTTEIKKILDAAFSSEPGNVRFAASW
NT seq 3021 nt NT seq  +upstreamnt  +downstreamnt
atgttacgtagatcgctgtttaacagcagattatgcagtaggaggctgctatccacctca
ataagagtatctcaagacacgctcaaacaacccccagcgccgttcgatgctttctctaca
actggcttggatcacgctttcttagaatctgcgtacggcgagtggagaaaggataacaac
tcggtgcacccttcttttgctacctactttgaagcactcgagaacggtgtagatccagct
gaggcttttgtaccaccaccaaaattggcaggtgctttggctgactctgctgcatctcca
aagcacacagatttgggcgatcacttgaaggcacaactcctcgttcgtgcgtatcaagtt
cgtggtcaccacttggccagcttggatccactcaaccttacacaaactgatgtaaacaat
atggtaccaccagaactcaaaatcgacagttatggttggtcagaacgcgatttagatcgt
caaattagcttgggtccaggtattttacctcgttttgctatcgacggacgtaacaaaatg
tctttgcgcgagatcatccaaacttgtgaacaaatttactgtggtccaatcggtatacag
tacattcacattcctgacaaggatcaatgtgactggctccgtaaaagagtcgaaattcct
cacccatggaggtacaatatcgaagagaagagcaacatcttagacagacttctctggtcc
acctgctgggagcaattcatcgctgctaaattccctaacgagaagcgtttcggtttggaa
ggagctgaatcactcattccaggtatgaaggctctcatcgacagagctgttgaccacggt
actaagcacatcaccattggtatgcctcatcgtggtcgtctcaacgtcctctcaaacgtc
atcagaaaaccatcagaggctatcttcaacgagttcaccggagcaaacgatgatactcaa
tctggcggtggtgatgttaagtatcacttgggtgctaactacactcgcccaaccccatca
ggaaagaaggtcaatttgtcacttgttgctaatccatcacacttggaagctgaaaaccca
attgttttaggtaaaacacgtgctttacaacatatcgaaggtgatgaaggcaaaggtgat
tcttcattaggtttgcttctccatggtgatggtgccttcgctgcacaaggtatcgtttac
gagacactcggtatggtcaacttgccaaactacggtactggtggtacaatccacgttgtc
gtaaacaaccaagttgccttcactactgacccagaagactcacgttcaactgcttaccca
actgacattgctaagtcaattgatgcaccaatcttccactgtaacggtgacaacgctgaa
gcagtcaccttcgttttccaattggccgccgacttcagagctaaattcaagaaggatgtt
gtcatcaacttagtttgttacagaaagcatggtcataacgaatctgatcaaccatcattc
acacaaccaatcatgtacgaagctattgctaagcaaccaacagctcttgctaaatacgtt
aagcaacttcaacaagaggaagctttcactgaaactcaaatggaggagcaccgtaaggca
gtctggtctaagctcgaaagtgctttcaagaacgcaccaaactacaaaccacacggtcgt
gaatggctgagttcatcatgggaaggtttcccatcacctgatgatctcgctgctagagtt
cttccaacagcaacaacaggtgtgaaacaagagaccttagaaaacattggtaaagtcatt
tcaactttcccagatggattcactccacacaagaatttggctagaattatcggtaaccgt
ggtaaaatggtcatggaaggaaagggaattgactggtcaactgctgaagcacttgctttc
ggttcattagcactcgaaaaaatccatgttagattatccggtcaagatgttgaaagaggt
acattttctcaaagacatgcgatccttgttgaccaacaaaatgagtcattgtacatgcct
ttgaaccaccttggtagcagacaagcaggcgttgtcgtatgtaactcatccttatctgaa
tttggtacgcttggatacgagcttggttactcgctcgtttcaccggataatctcacactt
tgggaagcccaattcggtgattttgcaaacaacgcgcaatgtatcatcgatcaattcatc
gcttcaggtgaacgtaaatggctccaacgtagcggtttggttatgtcccttccacatgga
tacgacggtcaaggtccagaacactcaagtggtagaatagaaagattcttacaattggct
gatgacaatccattcagtgtaccaactgaagaagaaatggcacgtcaacaccaagactgt
aacatccaagttgtttacccaaccactccagccaactacttccacgttcttagacgtcaa
gtccacagagacttccgtaaaccactcattttgttcttcagcaaagcgctccttcgtcac
ccaatggctcgctctactttggaagaaatgactggcgaaactcaattcgaaagatacatt
ccagaaaacagtgagaagatggtcgagccagagaaagtacgcaagcatatcttatgttcc
ggacaagtttaccacacattatacaaagagagagaggaaagacaagcttatgacgttgcg
atttcaagacttgaacaaatttcaccattcccatacgacttgattcaaagtcatttggac
aaataccctaacgctgagattacttggtgtcaggaagagccattgaataacggtgcatgg
tcatacgtttcacaaagattattgacattggtcaagcaaactaagcaccactctgagcgt
tggcctcaatatgtcggtagagatccatctagtagtgttgcaactggttcaaaggctgta
cacaccactgagattaagaagattttggatgctgctttctcaagtgaacctggaaacgtt
agattcgctgcatcatggtaa

DBGET integrated database retrieval system