KEGG   Wallemia mellicola: WALSEDRAFT_30161Help
Entry
WALSEDRAFT_30161  CDS       T03142                                 

Definition
(RefSeq) manganese and iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
wse  Wallemia mellicola
Pathway
wse04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:wse00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    WALSEDRAFT_30161
Enzymes [BR:wse01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     WALSEDRAFT_30161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_N Sod_Fe_C
Motif
Other DBs
NCBI-GeneID: 18471131
NCBI-ProteinID: XP_006960221
JGI: Walse1_30161
UniProt: I4Y6X1
LinkDB All DBs
Position
Unknown
AA seq 201 aa AA seqDB search
MAHELPQLPYAYNALEPFICEEIMTIHHTKHHQTYVNALNAAEKSFAEAQSAKDVKSQIA
LQAALKFNGGGHINHSLFWKNLAPAQSAEAKYPEGSAFAKAVERDLGGYENLKKEVTAAT
LGIQGSGWGWLALNSKNKRLEVITTANQDPVTPPHVPLFGIDIWEHAFYLQYKNVKPDYL
NAIFNVINWAETAKRYDDATK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcacacgaactcccacaactcccatatgcatacaacgcacttgaaccattcatttgc
gaggagattatgacaattcaccacacaaagcaccaccaaacctacgtcaacgcacttaac
gctgcagagaagagtttcgctgaagcacaatccgctaaagacgtaaagtcacaaattgca
ctccaggctgctcttaagttcaacggtggtggccacatcaaccactcactcttctggaag
aaccttgcaccagcacaatcagctgaagctaagtacccagaaggcagtgcattcgctaag
gccgtcgagcgtgaccttggtggctacgaaaacctcaagaaggaagtcaccgctgcgacc
ctcggtatccaaggctccggttggggttggttagctctcaactctaagaacaagcgtctt
gaagttatcaccaccgctaaccaagaccctgtcacccctccacatgtcccacttttcggt
attgacatttgggaacacgctttctacctccaatacaagaacgtcaagccagactacctt
aacgccatctttaatgtcattaactgggctgaaaccgctaagcgttacgatgatgctact
aagtaa

DBGET integrated database retrieval system