KEGG   Wallemia mellicola: WALSEDRAFT_31108Help
Entry
WALSEDRAFT_31108  CDS       T03142                                 

Definition
(RefSeq) succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
wse  Wallemia mellicola
Pathway
wse00020  Citrate cycle (TCA cycle)
wse00190  Oxidative phosphorylation
wse01100  Metabolic pathways
wse01110  Biosynthesis of secondary metabolites
wse01130  Biosynthesis of antibiotics
wse01200  Carbon metabolism
Module
wse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
wse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
wse_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:wse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WALSEDRAFT_31108
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    WALSEDRAFT_31108
Enzymes [BR:wse01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     WALSEDRAFT_31108
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 GIDA Pyr_redox_2 FAD_binding_3 DAO UPF0253
Motif
Other DBs
NCBI-GeneID: 18471251
NCBI-ProteinID: XP_006956287
JGI: Walse1_31108
UniProt: I4YI24
LinkDB All DBs
Position
Unknown
AA seq 642 aa AA seqDB search
MLRLRNIRGSALAGQRAFSTSKSLSRVVANEPLKAKQAENNAFASSNYPVIDHEYDALVV
GAGGSGLRAAFGLAEAGFKTACITKLFPTRSHTVAAQGGINAALGNMTQDDWRWHMYDTV
KGSDWLGDQDAIHYMCREAPRTVVELEHFGVPFSRTADGKIYQRAFGGQSLEYGKGGQAY
RCAAAADRTGHALLHTLYGQSLRHNTNFFIEYFALDLIMEDGECVGVMALNMEDGTLHRF
RSHKTVLATGGYGRSYFSCTSAHTCTGDGNAMVSRAGLPLQDLEFVQFHPTGIYGAGCLI
TEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPEKDHIYLQ
LSHLPPEVLHERLPGISETAAIFSGVDVTKEPIPVLPTVHYNMGGIPTKWTGEVLTIDDQ
GNDKVVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACANHIRDTWEAGKPHKKISE
NAGLFSIENLDKVRNATGPKPTSDIRLDMQKVMQSDAAVFRTEESLQEGVEKMRKVYDSY
AQLGITDRSMIWNTDLVESLELTNLLQCAMQTIVAAANRKESRGAHAREDYSERDDENWM
KHTLTFQKDVESNHVDLTYRAVEGNTLDESECKAVPPFKRSY
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgctcagactaagaaatatccgcggctcagcgctcgcgggacagcgtgcattctcaact
tcaaagtcgctcagcagagttgtagctaacgagccattgaaagctaagcaagcagagaac
aacgcttttgcttcttcaaactacccagttattgaccacgaatacgacgcattagtagtc
ggtgccggcggttccggtcttcgtgctgcatttggtctcgcagaagcgggattcaagaca
gcttgtattactaagctcttccctacgcgttcccacaccgtcgctgcacaaggtggtatt
aacgctgcacttggaaacatgacacaagacgactggagatggcacatgtacgataccgtc
aaaggttcagattggctcggtgaccaagatgctatccactatatgtgtcgtgaagcacca
cgtaccgtcgttgagctcgaacatttcggtgttcctttctcacgtaccgctgatggaaag
atctaccagcgtgccttcggtggtcaatccctcgaatacggtaagggtggtcaagcatac
agatgtgcagcagctgcagaccgtactggacacgctcttttacacacactctatggtcaa
tcccttagacataacaccaacttcttcatcgaatactttgcattggatttgatcatggaa
gatggcgaatgtgtcggtgttatggcactcaacatggaagacggtactctccacagattc
cgttcacacaagactgttcttgctactggtggatacggtcgctcttacttctcatgtacc
tccgctcacacttgtaccggtgatggtaacgcaatggtctcaagagcaggtttaccactt
caagatttagagttcgttcaattccacccaactggtatctacggtgctggttgtcttatc
actgaaggttcccgtggtgaaggtggttacctccttaactctgaaggtgaacgtttcatg
gaacgttacgcaccaactgctaaggatttggcttcacgtgacgtcgtttcacgttcgatg
actctcgaaatccgtgaaggtcgtggtgtcggtccagagaaagatcacatttacttgcaa
ttgtcacacttaccacctgaagtccttcacgaaagacttccaggtatctctgaaactgct
gccattttctccggtgtcgacgtaacaaaggagccaattccagtattgccaactgttcac
tacaacatgggtggtattccaaccaagtggacaggtgaggttttaacaattgacgaccaa
ggtaatgacaaggttgtacctggtttgtatgcagcaggtgaagcagcatgtgtatccgta
cacggtgctaacagattgggtgccaactcactccttgacattgttgtctttggtagagca
tgtgccaaccacattagagatacatgggaagccggtaaaccacacaagaagatctccgaa
aacgcaggtttattctcgatagaaaatctcgataaggttagaaacgcaaccggaccaaag
ccaacatcagacattagattagatatgcaaaaggttatgcaatctgatgcagcagttttc
agaactgaagagagtttgcaagagggtgtagagaagatgagaaaggtttacgattcatac
gcacaattgggtataaccgacagatcaatgatttggaacactgaccttgttgaatcgtta
gaattgacgaacttgttgcaatgtgctatgcagactattgtcgcagcagccaaccgtaaa
gaatcacgtggtgcacacgccagagaagactacagcgagcgtgatgatgaaaactggatg
aagcacacattgacattccagaaggacgttgagagcaaccacgtcgatctcacctaccgc
gccgttgaaggtaacacactcgacgagagtgaatgtaaagcagtaccaccatttaagcgt
tcttattag

DBGET integrated database retrieval system