KEGG   Wallemia mellicola: WALSEDRAFT_33262Help
Entry
WALSEDRAFT_33262  CDS       T03142                                 

Gene name
PkaC
Definition
(RefSeq) kinase-like protein
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
wse  Wallemia mellicola
Pathway
wse04113  Meiosis - yeast
wse04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:wse00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    WALSEDRAFT_33262 (PkaC)
  09143 Cell growth and death
   04113 Meiosis - yeast
    WALSEDRAFT_33262 (PkaC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:wse01001]
    WALSEDRAFT_33262 (PkaC)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:wse03019]
    WALSEDRAFT_33262 (PkaC)
   03036 Chromosome and associated proteins [BR:wse03036]
    WALSEDRAFT_33262 (PkaC)
Enzymes [BR:wse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     WALSEDRAFT_33262 (PkaC)
Protein kinases [BR:wse01001]
 Serine/threonine kinases: AGC group
  PKA family
   WALSEDRAFT_33262 (PkaC)
Messenger RNA biogenesis [BR:wse03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     WALSEDRAFT_33262 (PkaC)
Chromosome and associated proteins [BR:wse03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    WALSEDRAFT_33262 (PkaC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 18471649
NCBI-ProteinID: XP_006959437
JGI: Walse1_33262
UniProt: I4Y8W9
LinkDB All DBs
Position
Unknown
AA seq 433 aa AA seqDB search
MGLLEKLHIGHHSHSSSKDINSQNNQSKSSPAIPNSTTPNHPNTPPINNSDNDFSQQKDF
KSQVESSNNHSNKLHPSLAPSTQLDDNKPTQQQLQQPATPNSSYNKVQPRKTQGRYTLKD
FVLERTLGTGSFGRVHLVKSNHNSRFYAIKVLAKDQVVKMKQVEHTVSERDMLARVRHPF
LVNLWGTFQDPKNLYMVMDFVAGGELFSLLRKSQRFPNPVAKFYAAEVALALDYLHSLDI
IYRDLKPENILLGADGHIKITDFGFAKYVPDVTWTLCGTPDYLAPEIVQSKGYNKSVDWY
ALGVLIFEMLAGYPPFYTEDSNPMKLYEKIIANKPKFPSYFDPVAKDLLKQLLMADLSKR
FGNLQHGSRDVFTHEWFKEVDWNRLYNRAIPAPYIPKIAGDGDSSQFDKYQENDVSLYGQ
AGDDTWGHLFKEF
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgggtcttttagagaaattgcatataggccatcatagccatagctctagtaaagatatt
aactcacaaaataatcaatcaaagtcttctcccgctatccctaatagtactaccccaaat
catccgaatacgccgcctattaacaattctgacaatgatttttcacaacagaaagacttt
aaatctcaagtagaaagctcaaacaatcattctaataaactgcatccaagtttagcacct
tctactcagttggatgataataaaccaactcaacaacagctacaacaaccagctactcca
aattctagttataataaagttcaaccacgcaaaactcaaggaagatacactctgaaggat
ttcgtccttgaaaggaccttaggtaccggttcatttggacgtgtacatctcgtgaaatca
aatcataactctagattttatgctatcaaagtattagcaaaagatcaagtcgttaaaatg
aagcaagttgagcatactgtctccgagcgtgacatgttggcacgagttcgtcatcctttc
ttagtcaacttatggggcaccttccaagatccaaagaatctttacatggttatggacttt
gtcgctggtggtgaattattttctttacttcgtaaatctcagcgctttccaaatccagtg
gctaaattttacgctgcagaagtagctttagcacttgattatctccatagtttagatatt
atctatcgtgatctcaaacctgagaacattctacttggtgcagacggacatattaaaata
acggatttcggtttcgcaaagtatgtcccagatgttacatggacactttgtggtacacca
gattatttagctccagaaatagttcaatctaaaggctacaataaatcggttgactggtat
gcattgggtgttttaatatttgaaatgcttgctggttatccacctttctacactgaagat
tcaaatcctatgaaactatacgaaaagatcatcgcaaataagccaaagtttccttcttac
tttgacccagttgctaaagatctattgaagcaattattaatggccgatttatcaaaacgt
tttggtaacttacaacatggaagtcgcgatgtattcacgcatgagtggttcaaagaggta
gattggaacaggttatataatcgagcaattcctgctccttatatccccaaaatcgcgggt
gatggtgattctagccaatttgacaagtaccaagaaaacgatgttagtctttatggtcaa
gcaggagatgatacatggggacatctctttaaggaattttaa

DBGET integrated database retrieval system