KEGG   Wallemia mellicola: WALSEDRAFT_38547Help
Entry
WALSEDRAFT_38547  CDS       T03142                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
wse  Wallemia mellicola
Pathway
wse00052  Galactose metabolism
wse00500  Starch and sucrose metabolism
wse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    WALSEDRAFT_38547
   00500 Starch and sucrose metabolism
    WALSEDRAFT_38547
Enzymes [BR:wse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     WALSEDRAFT_38547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 18472069
NCBI-ProteinID: XP_006958564
JGI: Walse1_38547
UniProt: I4YC50
LinkDB All DBs
Position
Unknown
AA seq 921 aa AA seqDB search
MKYLPVVTASLLSSAFALTPLSSEDYGNRIRNCPGYAVNGAKTEQTVNGLKAHLQLAGDA
CDAFGDDVQNLVLEATYETKERLHIQIYDEKKKHFQVPEEIFERPQFTADESLKDNSDLQ
FEYSEAPFAFWISRRSDASISVMPNHNIIFEPQYIQLSSALTQNANIYGLGQVTSPSYRR
NSSYTRQSFWNADQGTPTDTNLYGTHPFYLENRVRGGASYNHGLFFLHTGGLETWLRDGL
IQFRAMSGIVDFYVISGGEGQNKPNDVIQQYSDLVGKPYLIPYWSLGFHLLRWGYYNDTA
LKASIYRMREERIPQESQWMDIEYMVKMRDFTVDPDSFSNLTNIVADLHEHGQKFIPMID
NGIPVPRNSSDKYPYYDSGHEKDVFMKNFNGTEYEGEVWPGWTVFPDPYAANTKEWWYES
LAKWHKEVPFDSVWLDMNEASSFCSGSCGTGSTELEQYEAEDVTYWAEGYNPEVSGNSGN
ITVDGQLTYMQSPMPTRREQLGRRMGTVDTIDKDKAEDLLARPPYQLHNGPPNKFNQLDL
TTISGNATHANGVAEYDVHNANGHMLARFTREALERIYNKQRSFIITRSTFAGSGKYTQL
WLGDNYSTWQSMRDSIKGLFQFSAFQMPFTGADACGFGGNTVEELCTRWMELAAFSPFMR
SHNTYNAIDQFPYTWDSTADASRKALKSRYELLPFFYTKLYQASIDGSAVVKPLWYEWPE
MQELFAWDEQYFLGDELLITPVLRPNTTTVEGYFPGDEPYYDIYTGEKLAPSADKVILDA
PLTHINVHVRGGSVLVKHSKADLTVTQTTASPFNIMVALNREKSAKGSYWFDDGSSEFGN
TSVTQLNIQVNANGITSDFGRNDYQLAQNLDKVTVAGCEMAPKQVKNNDMDVEFEHDADT
QVLTISGLKQSLNAPLNISWN
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatctcccagtagttactgcctcgctactgtcttcagcattcgcactcactccg
ctgtcttcagaggactacgggaataggatcagaaattgtcctggttatgctgttaacggt
gctaaaactgagcagacagtgaacggactcaaagcacatcttcaactagcgggcgatgct
tgcgatgcttttggagacgacgttcagaatcttgtattggaggctacttacgagactaag
gagcgtctccacattcaaatctacgatgaaaaaaaaaagcactttcaagtcccagaggaa
atcttcgagcgccctcaatttacagctgacgagtcactcaaagacaacagtgacttacag
ttcgagtattccgaggcaccgttcgcattctggatctcgagaagatcagatgcaagcata
tcagtcatgccaaaccacaacataatctttgagccacaatacatccaactctcctcagct
ctcactcaaaacgccaacatctatggtcttggtcaagtaacctcaccgagctaccgccgc
aacagctcatacacccgtcaatcattctggaatgcagaccaaggcacaccaaccgacacc
aacctctacgggacacatccattctatcttgagaatagggtcaggggtggtgcttcttac
aatcacggtctcttcttcttacatactggtggtctcgaaacttggctaagagacggtctt
atccagttcagagcaatgtcaggtattgttgacttctacgttatctcaggtggtgaaggt
cagaacaagcccaatgatgtcattcaacagtactctgacctcgtcggcaagccatactta
attccttactggagccttggtttccatcttctcagatgggggtactacaatgacactgct
ttgaaggcatcaatctacaggatgcgtgaagaaagaataccacaagagtcgcaatggatg
gatatcgaatacatggtaaagatgagagactttactgttgacccagactcattcagcaac
ctcaccaacattgtcgcagatttgcacgaacatggtcagaagtttataccaatgattgat
aacggtattccagtgccaaggaatagctcagataaatatccttattacgacagtggacat
gaaaaagatgtcttcatgaaaaatttcaatggcacagaatatgaaggtgaggtatggcct
ggatggacagtctttcccgatccttacgctgctaataccaaggaatggtggtatgaaagt
cttgcaaaatggcacaaggaggtaccttttgattccgtctggttggacatgaatgaagca
tcatcgttctgttctggatcatgcggtactggaagcacagagcttgaacaatatgaggct
gaggacgtgacctactgggcagaaggctacaatccagaagtcagcggcaatagcggtaat
atcacggtagacggccaactcacttacatgcaatctccaatgcccactcgccgtgaacag
ctcgggcgccgaatgggtactgttgacactatcgataaagataaagctgaagacttgctc
gctcgtccaccatatcaattacacaatggcccaccaaacaagtttaaccaactcgattta
accactattagtggaaacgccacacacgcaaatggagttgctgagtatgatgtccataac
gctaatggacacatgttggctaggttcactcgtgaggcattagaaagaatctacaacaag
cagcgctctttcatcattacaagatcaaccttcgctggaagcggaaagtatacacaactg
tggctcggtgacaattattcgacctggcaaagtatgagagactctataaagggcctgttc
caatttagtgctttccaaatgcctttcactggcgccgacgcatgtggctttggtggtaat
accgtcgaagagctatgtaccagatggatggagctcgctgcttttagtccattcatgaga
tcgcacaacacctacaatgcaattgatcaattcccgtacacttgggactcaaccgcagac
gcatcaagaaaggctctgaaatctcgttacgaactcttgccatttttctatacgaaactc
taccaagcaagtattgatggatctgcagttgtgaagccattgtggtacgaatggccagaa
atgcaagagctatttgcctgggatgagcaatatttcctcggtgatgaattacttatcaca
ccggtcctgaggccgaacacgacgaccgttgagggatacttcccaggtgatgagccatat
tacgatatttacactggtgagaagctcgctccaagcgctgacaaggtcatcctcgatgca
ccactcactcatatcaatgttcatgtccgcggtggttccgtactcgtcaaacactcaaag
gctgatttgacagtcacacagacgactgcgtcaccatttaacatcatggtcgcactcaac
agagaaaagtctgctaagggttcatactggtttgacgatggttcgtctgagttcggcaac
acctcagtcacacagctcaatatccaggttaacgctaacggtattactagtgactttggc
cggaacgactaccaacttgctcagaaccttgataaagttaccgttgcgggctgtgagatg
gccccaaaacaagtcaagaataacgatatggatgtcgagttcgaacacgatgctgatacg
caagtcctcaccatcagtggcctcaaacaatcactaaacgctccattgaacatctcttgg
aactag

DBGET integrated database retrieval system