KEGG   Wallemia mellicola: WALSEDRAFT_59783Help
Entry
WALSEDRAFT_59783  CDS       T03142                                 

Definition
(RefSeq) PLP-dependent transferase
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
wse  Wallemia mellicola
Pathway
wse00220  Arginine biosynthesis
wse00250  Alanine, aspartate and glutamate metabolism
wse01100  Metabolic pathways
wse01200  Carbon metabolism
wse01210  2-Oxocarboxylic acid metabolism
wse01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:wse00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WALSEDRAFT_59783
   00220 Arginine biosynthesis
    WALSEDRAFT_59783
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:wse01007]
    WALSEDRAFT_59783
Enzymes [BR:wse01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     WALSEDRAFT_59783
Amino acid related enzymes [BR:wse01007]
 Aminotransferase (transaminase)
  Class I
   WALSEDRAFT_59783
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 18473555
NCBI-ProteinID: XP_006957139
JGI: Walse1_59783
UniProt: I4YGL4
LinkDB All DBs
Position
Unknown
AA seq 497 aa AA seqDB search
MITRSIRVNRTINRSITTSSVNSIRLDNSTINSKVINAQYAVRGEIPVKADIYGQQIRDG
NGDKLPFKAIMPCNIGNPQQQGLNQKPLTFWRQVAALTECPELIDNTQLFPKDVRDRARE
LLNEIGSVGAYSHSKGVPFIREQVAKFLEARDGYPSDPENIFLTAGASGGVSLLFHLLLS
GDPDGVMIPIPQYPLYSASLALAGSRTIQYHLDENRGWELNMNLLEKSFNDAQSQGTEVK
ALVIINPGNPTGAILSEENMRDIARFAQKHELVLLADEVYQSNIYDKNKPFVSFKKVIKD
LKLDDLQLASFHSISKGFSGECGRRGGFVEYVNFSEDFLTEATKLASISLCPPLQGQIAV
DLMIRPPKEGEESYEQYRKEKDEVLASYASRSKLLAERFNQMEGVSCNNSEGAMYAFPQI
RLPQKAIDAAKKQGKSPDSFYCLELLDNTGICVVPGSGFGQAPDTLHFRTTCLVPGTEDY
INTIEKFHKEFMNKYRD
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgataacaagatcaattagagtaaatagaacgataaatagatcaataacgacttcctct
gtcaatagtatcagattagataatagtactataaattctaaagtaataaacgctcaatat
gcagtacgaggtgaaatacctgttaaagcagatatttatggacaacaaattagagatggg
aatggtgacaaactgccctttaaggctataatgccttgtaatattggtaacccacaacaa
caaggtttgaatcaaaagccattaactttctggagacaggtcgctgcactcaccgaatgt
ccggaactgatagataatactcaacttttcccaaaggatgtcagggatcgtgcacgtgaa
ttactcaatgaaattggctctgttggtgcttactctcatagtaaaggtgtacctttcatc
agagaacaagttgcaaaattccttgaagcacgagatggttacccttcagatccagagaat
atatttttaacagcaggtgcatccggaggtgtcagcttgttattccatttacttctctct
ggtgatcctgatggcgtcatgattccaattcctcaataccctctttactccgccagctta
gcattagctggttcacgcacgattcagtatcaccttgatgaaaaccgtggatgggaactg
aatatgaatttacttgagaagtcattcaacgatgcacaatcgcaaggtacagaggtgaag
gcactcgttattatcaatccaggtaacccaactggtgccattttaagtgaagaaaatatg
agagatattgcaagatttgcacaaaagcatgaattagttttacttgcagatgaagtttat
caatcgaatatttacgacaaaaacaaaccatttgtttcatttaagaaagtcattaaagat
ttaaagcttgacgatctacaactcgcttctttccacagtataagtaaaggtttcagtgga
gaatgtggtagaaggggtggattcgttgaatatgtcaacttttcagaggatttcctaact
gaagcaacaaagttggcatctatttcactctgtccacctttacaaggtcaaattgcggtc
gatctgatgataagaccacctaaagaaggcgaagaaagttatgagcagtatagaaaagaa
aaggatgaagtacttgctagctatgctagtaggtcaaagctgttagctgaaaggtttaac
caaatggaaggcgtttcatgtaacaattctgaaggagcaatgtatgcattcccacaaata
aggttaccacaaaaagcgatcgacgctgctaaaaagcagggtaaatccccagatagtttc
tattgtttagaattattggataacactggtatttgtgtagtaccaggtagcggatttggt
caagcccctgatacgcttcactttagaacgacgtgtttagttccaggtacagaagattac
ataaacacgatagagaaatttcataaagaatttatgaataaatacagagattaa

DBGET integrated database retrieval system