KEGG   Wallemia mellicola: WALSEDRAFT_60298Help
Entry
WALSEDRAFT_60298  CDS       T03142                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
wse  Wallemia mellicola
Pathway
wse00250  Alanine, aspartate and glutamate metabolism
wse00410  beta-Alanine metabolism
wse00430  Taurine and hypotaurine metabolism
wse00650  Butanoate metabolism
wse01100  Metabolic pathways
wse01110  Biosynthesis of secondary metabolites
Module
wse_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:wse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    WALSEDRAFT_60298
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WALSEDRAFT_60298
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    WALSEDRAFT_60298
   00430 Taurine and hypotaurine metabolism
    WALSEDRAFT_60298
Enzymes [BR:wse01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     WALSEDRAFT_60298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 18473870
NCBI-ProteinID: XP_006958201
JGI: Walse1_60298
UniProt: I4YD63
LinkDB All DBs
Position
Unknown
AA seq 531 aa AA seqDB search
MPLSKHIDTDKLIEQSRDDKARKLVQRASGEDSRKYASSPLFGRYGHAPLPKYQFPEKGV
DEHIAYQLIHDELSSDGTPLLNLASFVTTRQPESANKLILENLNKNIADQDQYKASFELQ
TRCVSMLADLWKVPKGNSAIGTITAGSSEGLLLGGLALKKIWQEKVKNATPKRSFKEPGP
NIIFASEAHCCVEKFARYFDVEARILPISKKSKYTLDPALVYEQCDENTIGVILIAGSTY
TGHVEDVLGVNNVLDKVQREKGYDIPIHVDAASGGFVLPFAFPSHKWAFNVPRVVSINAS
GHKYGGVYVGAGVVLWRDEKLLPKELIFEMHYLGSTELSFTLNFSRPATPVIAQYYNFIN
LGFEGYKTILENDLANARMLARALEASGYFEVLSDNHRPADGRKTDDNSLAEFYTPSLPV
VAFKWTDKFKSEHPHLEQKWLQILMKTKGWILPNYAMAKDLEDIEIVRAVIREELSEDML
DILVKDLVEVQESLTDMTSDFYKLAHAGSSKGPAEDNKKQDRSHQGYSRPC
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgccactatctaaacacatcgacacagacaagctgatcgaacaatcacgcgacgataag
gctaggaaacttgtgcagagagcatcaggagaggattcacgcaagtatgcctctagtcca
ctgtttggaagatatggccatgcgccactcccaaagtatcaattcccagagaagggtgtg
gatgagcacatcgcttatcagctcatacatgatgagctttctagtgatggaacaccacta
ctcaacttggcttcgtttgtgaccacacgtcagccagagagcgcgaacaaactcattttg
gagaacttgaacaagaatatcgcagatcaggatcaatataaagcttcgtttgagttacag
acacgttgtgtgtccatgttagctgatctctggaaagtccccaagggcaacagtgcaatt
ggtaccattacagctggttccagtgagggtttactcctcggtggtctcgcattgaagaag
atttggcaagagaaggtcaagaacgctactccaaagcgttctttcaaggaacctggacca
aacatcatcttcgcaagtgaagcacattgttgtgttgagaaattcgctcgctatttcgat
gtggaggcccgtattttacctatcagcaagaagagcaagtacacattagacccagcgctc
gtatacgaacaatgtgatgagaacaccatcggtgtaatcctcattgcaggaagtacatac
actggacacgtcgaagatgtcctgggagttaacaatgtacttgataaagtacaacgtgag
aaaggatacgacattccaatacatgtcgatgcagcatccggtggtttcgtcctcccattc
gctttcccatctcacaaatgggcgttcaatgttcctcgagttgtttcaatcaacgcgtct
ggtcataaatacggcggtgtctacgtcggtgctggtgttgtactctggagagacgagaag
ctcttacctaaagaactcattttcgaaatgcactatttgggatcaacagagctctcgttc
acacttaatttctcacgtccagctacacctgttatagcccagtattataatttcatcaat
ctcggtttcgagggatataagacaatcttggagaatgatctcgcgaatgcacgtatgcta
gcacgcgcattggaggcatcaggatactttgaagtactctctgacaaccacagaccagct
gatggacgcaagaccgatgacaactctttagctgagttctatacgccttcacttcccgtt
gtagcatttaagtggactgacaagttcaaatctgagcacccacatcttgaacagaagtgg
ctacaaattctcatgaagactaagggatggattttgccaaactatgctatggcgaaagat
ttggaagatatagaaatagttagagctgtcattcgtgaggagttgtctgaagatatgctt
gatattctcgtcaaggatctagttgaagtacaggagtcactcactgatatgacttcagac
ttctacaaactcgctcatgctggatcgtcaaagggacctgccgaagataataagaagcaa
gaccgctctcaccagggttactctcgtccatgctga

DBGET integrated database retrieval system