KEGG   Wallemia mellicola: WALSEDRAFT_60767Help
Entry
WALSEDRAFT_60767  CDS       T03142                                 

Definition
(RefSeq) glutathione S-transferase
Organism
wse  Wallemia mellicola
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_C_3 GST_N_2 GST_C_2
Motif
Other DBs
NCBI-GeneID: 18474152
NCBI-ProteinID: XP_006959158
JGI: Walse1_60767
UniProt: I4YAA7
LinkDB All DBs
Position
Unknown
AA seq 227 aa AA seqDB search
MSPQITLYACTGGPNPPKIAFLLEELGIDYEVKILQFGEGDDNKPGVKHPSFLKINPNGR
VPAIVDHSNGDFAVWESGAILQYLAETKGEKFIGTGKEKYEVLSWLAFQISGHGPMQGQV
NYFKHFFKNIWGEESSPTVVKRFETETYRVFSVLETQLASQKAAGSDYLVGKNYTIADIS
FHGWLRTVSFAGLDLSPYPHVKAWVDRNEAKESTKRANKKIADAAAA
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaattacactttatgcatgcacaggtggtcctaacccaccaaagatcgca
ttcttgcttgaagaattaggaatcgattatgaagttaagatcttacaatttggtgaaggt
gacgataacaagccgggagtaaagcatccatcttttttgaagatcaatccaaatggtaga
gtaccagcaattgtagaccactctaatggtgatttcgctgtgtgggaatctggcgcgatt
ctgcaatacctcgctgaaactaaaggtgaaaagtttatcggcactggtaaagaaaagtac
gaagttctttcatggttggctttccaaatttcaggacatggtccaatgcaaggacaagtt
aactatttcaagcacttctttaagaatatttggggtgaagagagctctcctacagtcgtt
aagcgtttcgagacagaaacctacagggttttcagcgttcttgagactcagcttgcatct
caaaaggctgctggcagtgattatctcgttggaaagaactatacaattgccgatatatca
ttccacggatggttacgtactgtcagctttgctggtttagatttgtcaccatatccacat
gttaaagcatgggtagaccgtaacgaagccaaggagagcacaaagagagcaaacaagaag
attgcggatgctgctgctgcttaa

DBGET integrated database retrieval system