KEGG   Wallemia mellicola: WALSEDRAFT_68650Help
Entry
WALSEDRAFT_68650  CDS       T03142                                 

Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
wse  Wallemia mellicola
Pathway
wse03030  DNA replication
wse03410  Base excision repair
wse03420  Nucleotide excision repair
wse03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:wse00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    WALSEDRAFT_68650
   03410 Base excision repair
    WALSEDRAFT_68650
   03420 Nucleotide excision repair
    WALSEDRAFT_68650
   03430 Mismatch repair
    WALSEDRAFT_68650
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:wse03032]
    WALSEDRAFT_68650
   03400 DNA repair and recombination proteins [BR:wse03400]
    WALSEDRAFT_68650
Enzymes [BR:wse01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     WALSEDRAFT_68650
    6.5.1.6  DNA ligase (ATP or NAD+)
     WALSEDRAFT_68650
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     WALSEDRAFT_68650
DNA replication proteins [BR:wse03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    WALSEDRAFT_68650
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     WALSEDRAFT_68650
DNA repair and recombination proteins [BR:wse03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     WALSEDRAFT_68650
   NER (nucleotide excision repair)
    Other NER factors
     WALSEDRAFT_68650
   MMR (mismatch excision repair)
    Other MMR factors
     WALSEDRAFT_68650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proteasome DNA_ligase_A_N DNA_ligase_A_M DNA_ligase_A_C Proteasome_A_N
Motif
Other DBs
NCBI-GeneID: 18475447
NCBI-ProteinID: XP_006957993
JGI: Walse1_68650
UniProt: I4YE06
LinkDB All DBs
Position
Unknown
AA seq 943 aa AA seqDB search
MARRYDSRTTIFSPEGRLYQIEYAMEAISHAGTCIGILAQDGVVLAAEKRVTSKLLDKAE
ASNEKIFNLNSNILAGVAGITADANSLVNYARMQAQKYLYTYDDNIPVEQLTQRLCDLKQ
GYTQYGGLRPFGVSLLYAGHDMHHGFQLYHSDPSGNYSGWKATCVGANNGTAQSLLKQDY
RDGVSLWSAAPNQQDETEGSKCGAVELACKILGKTLDATTIDSDKVEFAILKLDPKTGEP
KGHILKAPEIDKLLTKKEWTFHEETLVISSDSGSDNDDEIGNTGSIHTLNASSDSFVVPK
LDNAIQFILFVQACVECSSTRSRIEITNILTNYLRIVRKNDPDALLPSLWLFSSQLGPPY
EPNELGVGKLVLNGALKDVAALSPTRLKQLHNRLGDIGDVAFEATRNVISVVKPKPLTVS
QVYGTFKDIATQHGPRSVTAKTNLVKKLLVSAKAEQARWLMRALVQNLRIGAVRTTLSHA
LARAFAVGTPIDLPSAEKIVRRVYARHPNYTTLVKALLDSGLNELEMKVPVQVGTPVQPM
LGAITRSLADVQTRLRGQPFTSEAKLDGQRCQLHASLVDSKQKNGWTSPLVRDNTYLYVR
LFSRRLEDMTEKYPDAAMSLYEIFKNEPSLSSIVLDAEIAAIDDMDNIRSFQELSNRSRK
AVDVDEVKIRVAVFGFDCMLFNGETLLDKPFRERRSIMRTHVPPFKPSSITYAPWDHMPS
IDDTGLVEISAFFEKCMTMKAEGIMVKLLDYYEPTDTDDAVKTRRKALPATYEPDKRAES
WLKVKKDYLEDVGDSIDLVPIGAWHGMGRKNQFWSPILLGVYDDDEGAVTAVCKCMSGFS
DAFYKAIGERYAEGSSNVSKHAFPGVIIGDTSPDVYFQPSEVWECRGADITQSPVYPAAK
GRISDKGLSIRFPRFIRVREDKDVEQANTAADLASMYEKQQSG
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atggcgagaagatacgactcaaggacgacaatattcagtcctgaaggcaggctctatcaa
attgaatacgcgatggaagcgatctcgcacgctggaacttgtatcggtattttagcccaa
gacggtgtcgttttggcagcagagaagcgtgtaacttccaaactcctcgataaagcagaa
gcatcaaatgagaagatattcaacttaaactctaacattttagctggtgtcgctggtata
actgcagatgcaaactccttggtgaattacgcacgcatgcaagcacagaagtacctttac
acttacgacgataatatccctgtagaacaactcacacaaagactttgtgatttaaagcaa
ggatacacccaatacggtggtttgagaccatttggtgttagtttactctacgctggacat
gacatgcatcacggctttcaactataccacagtgatccttcaggtaactattctggctgg
aaagccacctgcgtcggtgcaaacaatggtactgcacaatcacttctcaagcaagactac
agagacggtgtgagcctctggtcagcagctcctaaccaacaagatgaaactgagggctca
aagtgtggcgctgttgaattggcatgtaagatactcggtaagacattagacgcgacgact
atagactcagataaggttgaatttgctatattaaaacttgatccaaaaacaggtgaacct
aaaggacacattttgaaagcaccagaaattgataaactactcacgaagaaagaatggact
tttcatgaagagacactcgtcatttcctcagacagtggctctgataacgatgacgaaatt
gggaacacaggcagcatacacactttaaacgcatcttccgatagtttcgtagtcccaaag
ctcgataatgctatacagttcatcctatttgtacaggcgtgcgttgaatgctcatcaaca
cgctcacggattgaaatcaccaacattttgacgaattatttgcgtatcgttcgtaaaaat
gatccagatgctttattaccatccctctggctattttcctcgcagcttggtccaccttat
gagccaaacgagctcggagtcggcaaattggtactcaacggtgcactcaaggacgtcgcc
gcactctcacccacacgactcaaacagcttcacaaccgtctgggtgatattggcgatgtc
gcattcgaggcgacccgtaacgtcatttctgtcgtcaaaccgaaaccattaacggtctcg
caagtttatgggacattcaaggatatagctacacaacatggtccgcgttctgtaacagcc
aagacgaaccttgtcaaaaagctacttgtatctgccaaagctgagcaagcgcggtggttg
atgagggcccttgtccagaatcttcgcatcggggctgtccgcacaacgctctcacatgca
ctcgcgagggcgtttgctgtaggtacaccaatagatcttccatccgctgagaagattgtc
agacgagtgtatgcgcgacacccaaactatacgacacttgtgaaggctcttctcgacagt
ggactcaacgagctggaaatgaaggtacccgtgcaagttggtacacctgtgcagccaatg
ctcggtgcaattacacgttcactagctgacgttcagactcgccttcgtggccagccattc
acgagtgaggcgaaacttgatggacaaaggtgtcaacttcatgctagtttggttgatagc
aagcaaaagaacggttggacttcacccctcgtacgcgataatacgtatctctatgtgcgg
ctattctccaggcgtctcgaagatatgacagagaagtatccagatgccgcgatgagtctt
tatgagatatttaagaatgaaccatcactcagcagcatcgttctcgatgcggaaattgca
gcaattgatgatatggataacattaggagctttcaggagttatcgaataggtcacggaag
gctgtagatgtagatgaagttaaaatacgcgtagctgtttttggattcgactgtatgcta
ttcaatggtgaaacactccttgataaaccgttcagagaacgacggtcgataatgcgaaca
cacgtgcctccgttcaagccatcttccattacctatgcaccctgggaccatatgccatca
attgatgatactggcctcgtagaaataagtgccttcttcgaaaagtgtatgacgatgaaa
gcagagggtataatggtgaaactgcttgattactatgagccaacggacacagatgacgcc
gtgaaaactcgtagaaaagcacttccagcgacatatgaacccgacaagcgagcagagagt
tggctgaaggtgaaaaaagactacctcgaagatgttggagatagcatagatttggtgcca
atcggagcatggcatgggatgggtcggaaaaaccaattttggtcgccaattctattaggt
gtttatgacgacgacgagggagcggtaactgccgtgtgtaaatgtatgtcaggattttct
gatgctttctataaagctatcggtgagcgctatgctgagggttcgtccaacgtctctaag
catgcatttcctggcgttataattggcgatacatctccggacgtatacttccaaccatca
gaagtatgggaatgtcgaggagcagacatcacacaatcaccggtttaccccgctgctaaa
ggacgtataagtgataaagggcttagtatacgtttcccgcgttttatacgggttagagag
gacaaggatgtcgagcaggctaatacagctgctgatttagccagtatgtacgaaaaacag
cagtctggataa

DBGET integrated database retrieval system