KEGG   Wallemia mellicola: WALSEDRAFT_70017Help
Entry
WALSEDRAFT_70017  CDS       T03142                                 

Definition
(RefSeq) UPF0220-domain-containing protein
  KO
K23327  protein Hikeshi
Organism
wse  Wallemia mellicola
Brite
KEGG Orthology (KO) [BR:wse00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:wse03110]
    WALSEDRAFT_70017
Chaperones and folding catalysts [BR:wse03110]
 Other chaperones and cochaperones
  Others
   WALSEDRAFT_70017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF775 UPF0220
Motif
Other DBs
NCBI-GeneID: 18475677
NCBI-ProteinID: XP_006959749
JGI: Walse1_70017
UniProt: I4Y8G9
LinkDB All DBs
Position
Unknown
AA seq 356 aa AA seqDB search
MSTRPTAYNPKRVCLLSLPDLSEFPKLREWGIYFAGMLFASGWWFFFDAAIISKRTKSDD
TFEDVPVRISFVDYIPAILSTFGMIIVSLINKSQISRENDDPYAWKARCWLFVGFALLAG
GLAGSVSLLVIKYIVPEYPSHYVSYGIAVVIQNIAIMLSTILTWIVGQSDTEYESAGRLV
QTDLQQVDETHFTFTLSKPEELNHVVIFLTGQIAFPEGIGATVHFLFPGYEKGWQLLGKL
SNDKPSAIFRLRGSAIPSKLSSNTLNTVNNNNTQAIIGISVEPINQVDSQTMALTPTNTI
SAKSNESQEVAKRILENLFEFLSGFAHVGPETLIPLSTLQQWYNKVLTKLQNGGSI
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagcactagaccaacagcttacaatccaaaacgcgtctgcttacttagtttaccggac
ttgagcgagttcccaaaactacgtgaatggggaatatactttgctggaatgctgttcgct
tctggatggtggtttttctttgacgccgctatcatttcaaagcgtacaaagtcagatgat
acatttgaagatgttccagtgagaatttcatttgtggattatataccagccattttgtcc
acatttggtatgatcatagttagtcttatcaacaaatcgcaaatttctagagagaatgat
gatccatacgcttggaaagcgcggtgctggttattcgttggatttgctttgttagccggt
ggattagcaggtagcgttagtttacttgttatcaaatacatcgtaccagagtatccaagt
cattatgtatcttatggtattgctgtcgtcatacaaaacattgctatcatgctctctact
atactgacatggatagttggacaatctgatacagaatacgaatcggctggtagacttgta
caaactgatttgcagcaagttgatgaaacgcactttacattcactttatcaaaacctgag
gaattgaatcatgtagttatcttcttgactggtcaaatcgcatttccggaaggtataggc
gcaacagtacacttccttttccctggatatgagaaaggatggcaattattaggtaaactg
agcaatgataaaccatctgctatattcagattaagaggtagcgcaattccatcgaaattg
agctcgaatacactcaacacggttaataataacaacacacaagcgattattggtatttct
gtagaaccaatcaatcaagttgatagccaaactatggccctcacaccaactaataccatt
tcagcgaaatcgaacgagagtcaggaagtagcgaaaagaattttggaaaatttattcgaa
ttcctctcaggatttgctcacgttggtccagaaacactcattccattatctacactccaa
caatggtataataaggttctcacgaagttacaaaatggaggaagtatatag

DBGET integrated database retrieval system