KEGG   Wolinella succinogenes: WS2049Help
Entry
WS2049            CDS       T00146                                 

Definition
(GenBank) PENICILLIN-BINDING PROTEIN 1A PBP-1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
wsu  Wolinella succinogenes
Pathway
wsu00550  Peptidoglycan biosynthesis
wsu01100  Metabolic pathways
wsu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:wsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    WS2049
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    WS2049
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:wsu01003]
    WS2049
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:wsu01011]
    WS2049
Enzymes [BR:wsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     WS2049
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     WS2049
Glycosyltransferases [BR:wsu01003]
 Polysaccharide
  Bacterial polysaccharide
   WS2049
Peptidoglycan biosynthesis and degradation proteins [BR:wsu01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   WS2049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase
Motif
Other DBs
NCBI-ProteinID: CAE11049
UniProt: Q7M7W1
LinkDB All DBs
Position
1943612..1945531
Genome map
AA seq 639 aa AA seqDB search
MKYLFALLVALFLGAAFMLARFYNDIRFEVDKIVHYESPMTTQILDRKGRLVANLFEHEF
RFYSPFEEIPPRIIEALAAVEDTLFFEHGGINLDAISRAMIKNIKSGRYTEGGSTITQQL
IKNVALSREKSLERKLKEALLAIRLETVLSKEEILERYLNHTYFGHGYYGIKAAARGYFK
KDMDRLSLKEVAILVGLPRAPSFYDPTKNLEFSLGRANNILQRMHSLGWITDEELDLSIG
EVPIVYNETLTQNIAPYVVDEVLKELRYIEDLKSGGYTIRLNIDLDYQEIAKEALTFGYE
QIKARRKKDDSDTLNGAIVVLENRTGKILAMVGGVDYRKSTFNRATQSKRQPGSSFKPFI
YQTALDLGYATNSPLADIARTYEYTANDEAKVWQPKNYGNTFSGIVPLKEALVKSLNLAT
INLVEEVGFERIYRKSLTYGFNNIPKNLSIALGSFGVSPLEMSRAYTLFSNYGTMMSPRL
IESITDYRGKTLSFDLESKVITPPEQSFLMIDVMREAVNKGTGRRARVNGIEIAGKTGST
NENVDAWFCGFTPTIQTVIWYGRDDNTPIGHNETGGVAAAPAFSYFFEKLLKIEPGIKRE
FDVPRNVHRIIKDGELYYYTDTSKPKEEAPSMKEENLIF
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatcttttcgcgctccttgtcgcgctcttccttggcgccgctttcatgcttgcc
cgtttttacaacgatattcgctttgaggtggacaagatcgtccactacgaatcacccatg
acgactcaaattcttgaccgaaaagggcgattagtcgccaatctttttgaacatgagttt
cgattctattcaccctttgaggagattccccctagaatcatcgaagccctagccgccgtg
gaggacaccctcttttttgaacatggaggaatcaaccttgatgcgatctctcgcgccatg
atcaaaaacatcaaaagcggtcgctacaccgaaggggggagcactatcactcaacagctc
atcaaaaatgtcgccctctcgcgcgaaaaaagcctagagcgaaagctcaaagaggcgcta
ttggccattcgccttgagaccgttctctccaaagaggagattttggagcgctatctcaat
cacacctattttggtcacggctactatggaatcaaagccgccgctagaggctatttcaaa
aaagatatggatcgcctaagccttaaagaggttgcgattcttgtcggactcccccgtgca
cccagcttctatgatcccaccaaaaatctcgaattctccctaggtcgcgccaacaatatc
ctccaaaggatgcactcgctaggctggatcaccgatgaggagctagacctatctattggc
gaggtgcccatcgtctataacgaaacactcacccaaaatatcgccccctatgtcgtggat
gaggtgctcaaggagcttcgctacatcgaagaccttaaaagcggcggctacacgattcgc
ctcaacatcgacctagactatcaagagatcgccaaagaggcgctcacctttggctatgag
cagatcaaggcgcgccgcaaaaaggatgactccgatacgctcaatggtgctatcgtggtg
ctagaaaatcgaacaggcaagattctcgcgatggtcgggggcgtggactaccgtaaaagc
accttcaatcgcgccactcaatccaaacgccagcctggaagtagcttcaagcctttcatc
taccaaaccgcactcgatttaggctatgcgaccaattcgcctctagcggatatcgctcgc
acctacgaatacaccgccaatgatgaggccaaagtatggcaacccaaaaactacggcaac
acctttagcggaatcgtccccctcaaagaggcactcgtcaagtcgctcaacctcgccacc
atcaacctcgtggaggaggtaggctttgagcgaatctatcgcaaaagcctcacctatggc
ttcaacaacattcccaagaacctctccatcgccctaggaagctttggtgtctctcccttg
gagatgagtcgtgcttacaccctcttctccaattatggcacgatgatgtcgccccgcctc
atcgagagtatcaccgactatcgcggcaaaaccctctcctttgatctagaatccaaagtg
atcactccacccgaacagagcttcttgatgattgatgtcatgagggaggcggtcaacaag
gggacgggtcgaagagctcgcgtgaatggaatcgagattgcaggaaaaacaggctcgact
aacgaaaatgtggacgcgtggttttgcggattcaccccaacaatccaaaccgtcatctgg
tatggcagagacgacaacacacctattggccacaacgaaacaggaggggttgccgcagcg
cccgccttctcctacttttttgagaaactgctaaagatcgaaccgggaatcaagcgagag
tttgatgtgccacgcaatgtccatcgcatcattaaagatggagagctctactactacacc
gacacctccaagcccaaagaggaggcgccgagtatgaaagaggagaatctaatcttttag

DBGET integrated database retrieval system