KEGG   Wolinella succinogenes: WS2062Help
Entry
WS2062            CDS       T00146                                 

Definition
(GenBank) PENICILLIN-BINDING PROTEIN
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
wsu  Wolinella succinogenes
Pathway
wsu00550  Peptidoglycan biosynthesis
wsu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:wsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    WS2062
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    WS2062
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:wsu01011]
    WS2062
Enzymes [BR:wsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     WS2062
Peptidoglycan biosynthesis and degradation proteins [BR:wsu01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   WS2062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: CAE11062
UniProt: Q7M7V4
LinkDB All DBs
Position
complement(1956703..1958538)
Genome map
AA seq 611 aa AA seqDB search
MSGRLKFFLIFFVSVWVILVVRIYFISIKSNTYYEELAKRNMIKTEFIVPIRGQILDRNG
EPLAVNELGFSLALPPRMSLRSKLAELEHQVELLAEFFPSLNKEETINHYKRQDSPYNHD
FINVVDFISYEEMHRLYPRLLQSDYIKILPSTKRFYPNKTTASHIIGYTGRADTKDIERT
PLSKFTGIVGKSGLERQYNDFLQGELGYRKIKVTAFNQEIELLEEKRPAENNDILLTLDL
RLQKAMDEEFAEKNGAAVVMNIHTGEVLAAGSYPEYDINDFVGGISYTKWNALREDPHNP
LLNKLINGTYPPGSVIKMGIGMALLEYAGINEHTVIETPEYIEFGGRKFRDWRVGGHGSS
DLVKSIKRSVDVYYYKLSQRAGMSNIAKVIEQMGFGRPTGIDLPNEFSGIVPSPEWKMKR
FKQPWYIGDTIVSSIGQGSFAVTPLQVARHTALLASGKLPTPHLAKSLGDIPKIYEPQEA
LSSFQKSKLPPIRLGMYQVCSEEGGTAYWHTRASKVSIACKTGTAQVVGISQTDKKRIRE
EDMDYFHRSHAWITGYFPYENPQYAVTVMVEHGGHGGSASGGILVKMANTLSDLGYIDTS
IEKGAKGNVKR
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
gtgagtggtcgtctgaaatttttcctgattttttttgtttcggtttgggtgattcttgtg
gtgcgaatctacttcattagtatcaaatccaacacctactatgaagagcttgccaagcga
aacatgataaaaaccgagtttatcgtgcctattcgcggacagattctagatcgaaacggc
gaacctctggcggtgaatgagctggggttctcgcttgcgcttccgcctcgcatgagtctt
cgctctaagctagccgagttagagcatcaagtagagcttttggcagagtttttcccttcg
ctcaacaaagaggagacgatcaatcactacaagcgccaagattccccctacaatcatgac
ttcatcaatgtggtggactttatctcctatgaggagatgcaccgcctctatcctcggctt
ttgcagagcgactatatcaagattcttcccagcaccaagcgattctatcccaataaaact
actgcctctcacattattggctacacaggaagggcggatacgaaagacatcgagcgcact
ccactatccaaattcacaggaatcgtgggcaaaagtggattggagcgccagtataatgac
tttttgcaaggagagcttggctatcgcaagatcaaagtgaccgccttcaaccaagagatc
gaactgcttgaagagaagcgtcccgccgaaaataatgacatccttttgacgctcgattta
agacttcaaaaggcgatggatgaagagtttgctgagaaaaatggcgcagcggtggtgatg
aatatccacacgggcgaggtcttggcggcaggaagttaccccgaatatgatatcaacgac
tttgtagggggaatctcttacaccaagtggaacgctctgcgcgaagatcctcacaacccc
cttcttaataagctcatcaacggcacctatcccccaggctcggtcattaagatggggatt
ggcatggcgctccttgaatacgctggaatcaatgaacacaccgtgattgagacgcccgaa
tatattgaatttggagggcgaaagtttcgagattggagggttggagggcatggaagctct
gacttggtcaaatcgatcaaacggagtgtggatgtctattattacaagctgagccaaagg
gcaggcatgagtaatatcgccaaggtgattgaacagatgggctttggtcgtcccacgggg
atcgatctgcccaacgagttctcaggcattgtccctagtcctgagtggaagatgaagcgc
ttcaagcagccttggtatatcggagacaccatcgtctcctccatcggccaaggctctttt
gccgttactcctcttcaggtggcacgacacacggcgcttctagcgagtgggaaattgccc
accccgcatcttgccaagagtttaggtgatattccaaagatctatgagccccaagaggca
ctctcctcttttcaaaaaagcaaacttccccctatccgtctagggatgtatcaggtgtgc
agcgaagagggggggacggcctattggcacacacgagcatccaaagtgtctatcgcttgc
aaaacaggaacggctcaggtggtggggatctcccagacggacaaaaagcgaatcagggaa
gaggatatggactactttcatcgctcccatgcctggatcacgggttattttccctatgaa
aatcctcagtacgccgttacggtgatggtggagcacggggggcatggagggagcgctagt
ggaggaatcttggtcaaaatggcgaatactttatcggatctagggtatattgatacgagc
atagagaagggagctaaaggcaatgttaaacggtaa

DBGET integrated database retrieval system