KEGG   Wolinella succinogenes: WS2148Help
Entry
WS2148            CDS       T00146                                 

Definition
(GenBank) SPERMIDINE SYNTHASE SPEE
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
wsu  Wolinella succinogenes
Pathway
wsu00270  Cysteine and methionine metabolism
wsu00330  Arginine and proline metabolism
wsu00410  beta-Alanine metabolism
wsu00480  Glutathione metabolism
wsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    WS2148
   00330 Arginine and proline metabolism
    WS2148
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    WS2148
   00480 Glutathione metabolism
    WS2148
Enzymes [BR:wsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     WS2148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth Spermine_synt_N
Motif
Other DBs
NCBI-ProteinID: CAE11142
UniProt: Q7M7Q6
LinkDB All DBs
Position
2030521..2031309
Genome map
AA seq 262 aa AA seqDB search
MWVTRQDSVNFQQEYLIENKILDARSEKNTLEIFKSPAFEEIALLNQKQLLLKTLLSQES
ELLAHVPLCVHPTPKRVLIAGSFNLEVAFEALRHEETQVDFLQKDEKILHSLISFFPHFQ
ETLHHPRFRVIEEIDSLKSYEVIIHTSLLSLEEIAPLFASLSLDGIFITRLENLLLHTES
MRRYLLGIAHHFSIAMPFVSPFSLNADSHFLFASRRFHPQADLLLQRADMLEGLHCYHAE
LHESAFVLPKFLADSLQGSIKN
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtgggtgacacgacaagatagtgtgaatttccagcaagagtatctcatcgaaaacaag
attttggatgcccgaagcgaaaagaatacgctagagatattcaaaagccctgcctttgaa
gagatcgcgctcctcaatcaaaaacagcttcttcttaaaaccctgctctcccaagagagc
gagcttttagcgcatgttccgctttgcgttcaccccactccaaagagggtgcttatcgcg
ggaagtttcaatctggaggtcgcctttgaagcattgcgccacgaagagacccaagtggat
tttctccaaaaagatgagaagattcttcactctctaatcagcttttttcctcactttcag
gagacccttcatcatccgcgatttcgcgtgattgaagagatcgattctttgaaaagctat
gaagtgatcatccatacttcactcctctctctggaggagattgctccgctttttgcctcc
ctctctttggatggaatctttatcactcgccttgaaaacctcctcctccacaccgaatca
atgcgtcgctatctcctaggaatcgctcaccactttagcattgcgatgccttttgtctct
cctttttcgctcaatgctgatagccatttcctcttcgcctcacgccgcttccacccccaa
gccgacctcctgcttcagagggctgatatgctagagggtctgcactgttaccatgcagag
cttcatgagagcgcgtttgtgcttcctaagtttttagccgattccctccaaggttcgatc
aaaaactga

DBGET integrated database retrieval system