KEGG   Wolinella succinogenes: WS2172Help
Entry
WS2172            CDS       T00146                                 

Definition
(GenBank) ANTHRANILATE SYNTHASE COMPONENT II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
wsu  Wolinella succinogenes
Pathway
wsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
wsu01100  Metabolic pathways
wsu01110  Biosynthesis of secondary metabolites
wsu01130  Biosynthesis of antibiotics
wsu01230  Biosynthesis of amino acids
wsu02024  Quorum sensing
Module
wsu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:wsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    WS2172
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    WS2172
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    WS2172
Enzymes [BR:wsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     WS2172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26 MoCF_biosynth DUF2686
Motif
Other DBs
NCBI-ProteinID: CAE11163
UniProt: Q7M7P2
LinkDB All DBs
Position
complement(2051557..2052129)
Genome map
AA seq 190 aa AA seqDB search
MVLMIDNYDSFTYNIVQYCLELGADLRVIRNDEMSVEAIKALSPQKIILSPGPSTPNEAG
VTLEVIEKLKGIVPILGVCLGHQAIGQAFGGEVVRAAHMMHGKTSTIKIVVPTPIFEGLP
EEFTATRYHSLIVKKENLPDILEPTAYSTDDGEIMALQVRGYPIYGVQFHPESIMSHYGH
EIFKNFLERG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggtattaatgatcgacaactacgattccttcacctacaacattgttcagtattgccta
gaattaggcgcagatttgagggtgattcgtaatgatgagatgagcgtagaagccattaag
gcgctctctccgcaaaaaatcatcctctcccctggaccttccacccccaatgaggcgggg
gtgacgctggaagtgattgaaaagctcaagggaatcgtcccgattcttggggtctgtttg
gggcatcaagcgattggtcaagcctttggcggggaggtggtgagggctgctcatatgatg
catggcaaaacctccacgatcaagattgttgtacctacgcctatttttgaaggattgccc
gaagagtttacagcgactcgataccattcgctcattgtcaaaaaggagaacctacctgat
attttggagccaaccgcctacagcacggatgatggcgaaatcatggcgttgcaggtgagg
ggctatcctatctatggcgtgcagtttcaccctgaatcgatcatgagccactatggacat
gagattttcaaaaatttccttgagcggggatag

DBGET integrated database retrieval system