KEGG   Weeksella virosa: Weevi_1186Help
Entry
Weevi_1186        CDS       T01441                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
wvi  Weeksella virosa
Pathway
wvi00020  Citrate cycle (TCA cycle)
wvi00480  Glutathione metabolism
wvi01100  Metabolic pathways
wvi01110  Biosynthesis of secondary metabolites
wvi01120  Microbial metabolism in diverse environments
wvi01130  Biosynthesis of antibiotics
wvi01200  Carbon metabolism
wvi01210  2-Oxocarboxylic acid metabolism
wvi01230  Biosynthesis of amino acids
Module
wvi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
wvi_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:wvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Weevi_1186
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Weevi_1186
Enzymes [BR:wvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Weevi_1186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ADX67895
UniProt: F0P2Y3
LinkDB All DBs
Position
1250044..1252260
Genome map
AA seq 738 aa AA seqDB search
MSKSKIFYTLTDEAPMLATHSFLPIVKAFTKSADVEIAVPDISLAGRILANFSSYLKDDQ
KVADALIELGELATKPEANIIKLPNISASIPQLEGAIAELQAKGYAVPNYPAEPKNEEEK
AIKAQYAKVLGSAVNPVLREGNSDRRAPKAVKNYAKANPHRMGDWTKDSQTDVAHMDHGD
FYGTETSTTIENATKFRIVFKSIDGKEEVLKDFAPLQAGEVIDSSVMNINALKEFVKSAI
GEAEKRNVLLSAHLKATMMKISDPIIFGAIVETYFSDVFAKYAETFKSLDISPNNGLAGL
FEKIKGNPQEEEIKADIAKTIENGPRLAMVNSDKGITNFHVPSDVIVDASMAALVRGGGK
MWNKDGNEEDTIAIIPDRSYAGFYQSVIDDMKANGKLDPTTMGSVPNVGLMAQKAEEYGS
HDKTFQAQANGTIEVQSEDGAVLLSQKVEKGDIFRMCQTKDAPIQDWVKLAVNRSRLSET
PAIFWLDKERAHDREIIKKVEKYLGDHDTKGLDIRIMDVKDAMTETLKRAREGKDTISVS
GNVLRDYLTDLFPILELGTSAKMLSIVPLMNGGGLFETGAGGSAPKHVQQFVEEGYLRWD
SLGEFLALQASLEHLAQTQNNPKAQILADALDQANAEFLSTNKSPGRKLGTIDNRGSHFY
LAMYWAKALAEQTKDEELAKLFAPIAAKMKEQEDKINEELIGAQGKPQDIGGYYKTDFSK
TDAAMRPSATLNEIIQSI
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaatcaaaaattttttacacccttacggatgaagcaccgatgttagctacacac
tcttttttaccgattgtgaaagcctttacgaaatctgctgatgtcgaaattgctgtgcca
gatatttcattagctgggcgaattttagccaacttttcatcctatctaaaagatgaccag
aaagtagccgatgcattgatcgagttgggtgaattggccacaaaaccagaagccaatatc
atcaaattaccaaatatttctgcttctatacctcagttagagggagctattgcagaatta
caggccaaagggtatgcagtgccaaattatccggcggaacctaaaaatgaagaggaaaaa
gcgattaaagcacaatatgcaaaagttttaggaagtgctgtaaatcctgtattgcgtgaa
ggaaactctgaccgtcgtgcaccaaaagcagtgaaaaattatgccaaagcaaatcctcac
cgcatgggcgattggacaaaagatagccaaacagatgtagcgcatatggatcatggtgat
ttttacgggaccgaaacttctaccaccatagaaaatgcaacgaaatttcgtattgttttt
aaaagcatagatggaaaagaagaagtcctgaaggattttgctcctttgcaagccggagaa
gtaatcgattcatctgtgatgaatattaatgcactgaaagaatttgtaaaaagtgcaatt
ggcgaagccgagaaaagaaatgttttgctttctgctcacttgaaagcgacaatgatgaaa
atctctgacccaataatttttggagcaattgtagaaacctatttttctgatgtttttgca
aaatatgcagaaactttcaagtcattggatatcagtccgaacaacggattggccggactt
ttcgagaaaatcaaaggtaatcctcaagaagaagaaatcaaagcagatattgctaaaaca
atcgagaatggaccacgtttggcaatggtaaattcagataaaggaattaccaattttcat
gttccatcagatgtgattgttgatgcatctatggccgccttggttcgcggaggtggaaaa
atgtggaacaaagatggaaacgaagaagacaccattgcgattattcctgatcgttcgtac
gcaggtttctatcagtcggtgattgatgatatgaaagcgaacggaaaattagatcctacg
acaatgggttctgtcccgaatgttggtttgatggctcaaaaagctgaagaatacggatcg
cacgataaaactttccaagcacaagcaaacggtacaatcgaagttcagtcagaagacgga
gcagttcttttatcacaaaaagtagaaaaaggtgatatcttcagaatgtgtcaaaccaaa
gatgcaccaatacaagactgggtaaaattagcggttaaccgctctcgcttatcagaaaca
cccgctattttctggttagataaagaacgtgcacacgatagagaaatcatcaaaaaagta
gaaaaatacttaggagaccatgatacaaaaggtttggatattcgcattatggatgtaaaa
gatgccatgaccgaaaccttgaagcgtgcgcgcgaaggaaaagatactatttctgtttct
ggaaatgttttacgtgattatctcacagatcttttcccaatcttagaattaggtacatct
gcaaaaatgttatcaatcgttccgttaatgaacggtggtggacttttcgaaaccggagca
ggaggttcagccccaaaacacgtacaacaattcgtagaagaaggctatttacgttgggac
tctttaggagaatttttagcgcttcaagcttcattagaacatttggcacaaacccaaaat
aatccgaaggcacaaatcttggcagatgctctagatcaggcaaatgcagagtttttatca
accaataaatcaccaggtagaaaactaggaactatcgataaccgtggttctcatttctat
ttagcaatgtattgggcaaaagctttagcagagcaaaccaaagacgaagagttggctaaa
ttgtttgcaccaattgctgcaaaaatgaaagaacaagaagacaaaatcaatgaagaattg
attggtgcacaaggtaaaccacaagatattggcggatattacaaaaccgatttctcgaaa
accgatgctgcaatgcgcccttcggcaacactgaacgaaatcattcaatctatctaa

DBGET integrated database retrieval system