KEGG   Xanthomonas citri pv. citri 306: XAC0129Help
Entry
XAC0129           CDS       T00084                                 

Gene name
aldA
Definition
(GenBank) chloroacetaldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac00010  Glycolysis / Gluconeogenesis
xac00620  Pyruvate metabolism
xac01100  Metabolic pathways
xac01110  Biosynthesis of secondary metabolites
xac01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XAC0129 (aldA)
   00620 Pyruvate metabolism
    XAC0129 (aldA)
Enzymes [BR:xac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     XAC0129 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AAM35021
UniProt: Q8PR37
LinkDB All DBs
Position
151964..153493
Genome map
AA seq 509 aa AA seqDB search
MNALASAKSLNNDPHSIFKPRYDNFIGGQWVAPHSGQYFDNTTPINGKVFTSIARSTAPD
IEAALDAAHAAKDAWGKTSTTERSNVLLKIADRIEQNLELLAYAETWDNGKPVRETLNAD
VPLCVDHFRYFAGAIRAQEGGISEIDSDTIAYHFHEPLGVVGQIIPWNFPLLMACWKLAP
ALAAGNCVVMKPAEQTPASILVLMELIGDLLPPGVLNVVNGFGLEAGKPLASNPRIAKIA
FTGETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVMAEDDDFLDKAVEGFVLFAFNQ
GEVCTCPSRALIQESIYDAFMEKALSRVAAIKQGNPLDPNTMVGAQASSEQLEKILSYID
IGKQEGAEVLIGGERNTLDGDLAEGFYVKPTVFKGHNKMRVFQEEIFGPVVSVTTFKDEA
DALAIANDTLYGLGAGVWSRDASRLYRMGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIG
RENHKMMLDHYQQTKNLLVSYSPKALGFF
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgcttgcctctgcaaaatcgctcaacaacgatccgcactccatcttcaaaccg
cgctacgacaacttcatcggcggccagtgggtagcgccgcacagcggccagtacttcgac
aacaccacgccgatcaacggcaaggtctttacctcgatcgcgcgctccaccgccccggat
atcgaagcggcgctggatgccgcgcacgcggccaaggatgcgtggggcaagacctccacc
accgagcgctctaacgtattgctcaagatcgccgaccgcatcgaacagaatctcgaactg
ctcgcgtacgccgagacctgggacaacggcaagccggtgcgcgaaacgctcaatgccgac
gtgccgttatgcgtggaccacttccgctatttcgccggcgccatccgcgcgcaggaaggc
ggcatttccgagatcgacagcgacaccatcgcgtatcacttccacgaaccactgggcgtg
gtggggcagatcatcccgtggaatttcccgctgctgatggcgtgctggaaactcgcaccg
gcgcttgccgccggtaactgcgtggtgatgaagccggcagagcagacgcctgcctcgatc
ctggtgttgatggaactcatcggcgacctgctgccgcctggcgtgttgaacgtggtcaac
ggcttcggcctggaggccggcaagccgctggccagcaacccgcgcatcgccaagattgcg
ttcaccggcgaaaccaccaccggccggctgatcatgcagtacgccagccagaacctgatt
ccggtgacgctggagctgggtggcaaatcgcccaacatcttcttcgccgatgtgatggcc
gaagacgacgattttctcgacaaggcggtggaaggcttcgtgctgttcgctttcaaccag
ggcgaagtgtgtacctgcccgtcgcgcgcgctgatccaggagtccatctacgacgccttc
atggaaaaggcgctctcgcgcgtggccgcgatcaagcagggcaatccgctcgaccccaac
accatggtcggtgcgcaagcgtccagcgaacagttggaaaaaatcctctcctatatcgac
atcggcaagcaggaaggcgccgaagtgttgattggcggcgagcgcaacacgctcgatggc
gacctggccgaaggtttttacgtcaagcccacggtgttcaagggccataacaagatgcgc
gtgttccaggaggagatcttcggcccggtggtctcggtcaccaccttcaaggacgaagcc
gatgcgctggcgatcgccaacgacacgctgtacggcctgggtgccggtgtctggagtcgc
gacgcttcgcgcctgtatcggatgggccgtgcgatccaggctggccgcgtgtggaccaat
tgctatcacgcctatcctgcgcatgctgcattcggcgggtacaagcagtcgggtatcggc
cgcgagaatcacaagatgatgctcgaccactatcagcagaccaagaacctgttggtgagc
tattcgccgaaggcgctggggtttttctaa

DBGET integrated database retrieval system