KEGG   Xanthomonas citri pv. citri 306: XAC0882Help
Entry
XAC0882           CDS       T00084                                 

Gene name
badH
Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac00010  Glycolysis / Gluconeogenesis
xac00053  Ascorbate and aldarate metabolism
xac00071  Fatty acid degradation
xac00280  Valine, leucine and isoleucine degradation
xac00310  Lysine degradation
xac00330  Arginine and proline metabolism
xac00340  Histidine metabolism
xac00380  Tryptophan metabolism
xac00410  beta-Alanine metabolism
xac00561  Glycerolipid metabolism
xac00620  Pyruvate metabolism
xac00625  Chloroalkane and chloroalkene degradation
xac00903  Limonene and pinene degradation
xac01100  Metabolic pathways
xac01110  Biosynthesis of secondary metabolites
xac01120  Microbial metabolism in diverse environments
xac01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XAC0882 (badH)
   00053 Ascorbate and aldarate metabolism
    XAC0882 (badH)
   00620 Pyruvate metabolism
    XAC0882 (badH)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XAC0882 (badH)
   00561 Glycerolipid metabolism
    XAC0882 (badH)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XAC0882 (badH)
   00310 Lysine degradation
    XAC0882 (badH)
   00330 Arginine and proline metabolism
    XAC0882 (badH)
   00340 Histidine metabolism
    XAC0882 (badH)
   00380 Tryptophan metabolism
    XAC0882 (badH)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XAC0882 (badH)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XAC0882 (badH)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    XAC0882 (badH)
Enzymes [BR:xac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     XAC0882 (badH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AAM35770
UniProt: Q8PP06
LinkDB All DBs
Position
complement(1043909..1045378)
Genome map
AA seq 489 aa AA seqDB search
MEALSETLRGIAARGPLGLFIDGQWRASTGDRTVDVIAPHTEERLLRYTEPSPSDTEAAI
AAARSAFDNGPWPQLSPQERSVVLKRVADHLRARMPELAEAWTGQVGATLGFSKRASQQA
PDLFDYYADLIATHAFVQPRVRPSGGRVHVVQEPVGVVAAITPWNAPLVLLCYKVAAALA
AGCTVVAKPSPETPIDAYILAECISAAGVPDGVFNLLPAGREVGEQLIRHPHVDKISFTG
STQAGRSIGIACAERLARVGLELGGKSAAIVLEDADLAKMLPTLVPYSMPIAGQVCFSLT
RVLVPTQRREEILQAYCTALSAVKLGDPFAADTGMGPLALGRQLERVQSYIAKGKAEGAR
LVMGGSRPAHLSRGFFVEPTVFAEVMPDMAIAREEIFGPVVSFIDYHDEADLIAKANASD
YGLHGTIYSEDAERAYRIARRVRSGSHAINGMWVDISMPFGGFKHSGIGREGGIEGLHAF
LETRTLYLS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaagccttgtccgaaacgctgcgcgggatcgccgcaaggggtccactgggcctgttt
atcgatgggcaatggcgcgcaagcaccggcgatcgcaccgtcgatgtgatcgcgccgcac
accgaagaacggctgctgcgctacaccgaaccctcgccctcagataccgaagcggccatc
gccgctgcacgcagcgcattcgacaacggcccctggccgcagctctccccgcaagagcgt
agcgtagtgctcaagcgggtggccgaccacttgcgcgcacgcatgccggagttggccgaa
gcatggacgggccaggtgggcgccaccctcggcttcagcaagcgcgcgtcgcagcaggcg
ccggatctattcgattactacgccgatctgattgccacccatgcattcgtccaaccgcgt
gtgcgccccagcggtggccgcgtgcatgtggtgcaggagccggttggcgtggtcgccgca
atcacgccctggaacgcgccgctggtattgctgtgctacaaggtcgccgccgcactggct
gccggttgcacggtggtggccaagccctcgccggagacaccgatcgatgcctatatcctg
gccgagtgcatcagcgccgccggcgtgcccgatggcgtgttcaacctgctccccgccggc
cgcgaggtgggcgagcaattgatccgccacccgcacgtcgacaagatcagcttcaccggc
tccacccaggccggtcgctcgatcggcatcgcctgcgccgagcgcctggcacgggttggc
ctggagctgggcggcaaatcggccgcaatcgtgcttgaagatgccgacctcgcgaagatg
ctgcccaccttggtgccttactccatgccgatcgccggacaggtgtgcttctcattgacg
cgcgtcctggtgccgacgcagcgccgcgaagaaatcctgcaggcgtattgcacggcactg
agcgcagtgaaactgggcgacccgtttgcggcagacaccggcatgggcccgttggccttg
ggccgccagctcgaacgtgtgcagtcctacatcgccaaaggcaaggccgagggcgcacgc
ctggtcatgggtggtagccgtccggcacacctgtcgcgcggcttctttgtcgaaccgacg
gtgtttgccgaggtgatgcccgacatggccattgcgcgcgaggaaatcttcggaccggtg
gtgagcttcatcgactaccacgacgaagccgacctcatcgccaaggccaatgccagcgac
tacggtttgcacggcaccatctacagcgaagacgccgaacgcgcctatcgcatcgcgcgc
cgcgtgcgcagcggcagtcatgcgatcaacggcatgtgggtagatatcagcatgccattc
ggtggcttcaagcactcgggcatcggccgcgaaggcggtatcgaaggcctgcatgccttc
ctcgaaaccagaaccctctacctgagctag

DBGET integrated database retrieval system