KEGG   Xanthomonas citri pv. citri 306: XAC1330Help
Entry
XAC1330           CDS       T00084                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac00230  Purine metabolism
xac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xac00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    XAC1330
Enzymes [BR:xac01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     XAC1330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CYTH
Motif
Other DBs
NCBI-ProteinID: AAM36201
UniProt: Q8PMU5
LinkDB All DBs
Position
1535777..1536274
Genome map
AA seq 165 aa AA seqDB search
MPTEIERKFLVTGDGWRDAAHAVIPMAQGYINDQAALRSGTQHASVRVRIQGESAFLNLK
SREVGHTRQEFEYPIPLADARALLALCVGGLIDKRRHLVAYQGHVWEVDEFLGDNAGLIV
AEIELERPDEAFATPEWLGTEVTDDVRYYNLALASHPFKQWNGDL
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcccacagaaatcgaacgcaaattcctggtcaccggcgatggctggcgcgacgccgcg
catgcggtgattccgatggcgcagggctatatcaacgaccaggcggcgctgcgcagcggc
acgcagcatgcctcggtacgggtgcgcattcagggcgaaagcgcatttctcaatctgaaa
tcgcgcgaagtggggcatacgcggcaggagttcgaatatccgattccacttgccgatgca
cgcgcattgctggcgctgtgcgtaggcggcctgatcgacaaacgccggcatctggtcgcc
taccagggccatgtgtgggaagtggacgaattcctcggcgacaacgccggtctgatcgtg
gccgagatcgaactcgaacgccccgacgaagcattcgccacaccggaatggctcgggacc
gaagtcaccgacgacgtgcgctattacaacctggcgttggcctcgcatccgttcaagcag
tggaacggggatttgtga

DBGET integrated database retrieval system