KEGG   Xanthomonas citri pv. citri 306: XAC1341Help
Entry
XAC1341           CDS       T00084                                 

Gene name
lig2
Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac03030  DNA replication
xac03410  Base excision repair
xac03420  Nucleotide excision repair
xac03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:xac00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    XAC1341 (lig2)
   03410 Base excision repair
    XAC1341 (lig2)
   03420 Nucleotide excision repair
    XAC1341 (lig2)
   03430 Mismatch repair
    XAC1341 (lig2)
Enzymes [BR:xac01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     XAC1341 (lig2)
    6.5.1.6  DNA ligase (ATP or NAD+)
     XAC1341 (lig2)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     XAC1341 (lig2)
DNA replication proteins [BR:xac03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    XAC1341 (lig2)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     XAC1341 (lig2)
DNA repair and recombination proteins [BR:xac03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     XAC1341 (lig2)
   NER (nucleotide excision repair)
    Other NER factors
     XAC1341 (lig2)
   MMR (mismatch exicision repair)
    Other MMR factors
     XAC1341 (lig2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AAM36212
UniProt: Q8PMT5
LinkDB All DBs
Position
complement(1547457..1549061)
Genome map
AA seq 534 aa AA seqDB search
MKRFAALYRTLDRATGTLDKRAALVAYFRDAPALDAAWALYLLAGGKVASARMRIASSGE
LREWITDTAGIADWLVADSYDHVGDLAETLALLLDDPVTEAADLPLAQWIEQRLLPIANQ
DVDVRKACIVQAWRSLAFDERLAFNKLLTGALRVGVSQRLVQQALAELSGVDIARIAQRM
LGSWRPHPTYLAELLTSEELPGDRQQPYPFFLASPLEAEVETLGAIDDWLLEWKWDGIRL
QLIRRAGEAALWSRGEERLDGRFPEIEHAAMQLPDGTVIDGELLAWQPEQPLPMPFTALQ
TRIQRLKPGPKTLAAAPARVVAYDLLELAGEDLRERPLRERRALLEGVLFALADPRIVAS
PLVQVSDWQAAAHVRVEARERGVEGLMLKRASSMYQSGRRRGDWWKWKIDPLTIDAVLLY
AQAGHGRRSTLYTDYTFGLWHEGQLVPIAKAYSGLDDKEILQLDRWIRANTTERFGPVRA
VTAHHVFELGFEAVNRSARHKSGIAVRFPRILRWRHDKPMAEADHLSTLQALAR
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgtttcgcggcgttgtaccgcaccctggatcgcgccaccggtacgctcgacaag
cgcgcggcactggtcgcgtatttccgcgatgcacccgcgctggacgcggcatgggcgctg
tacctgctggccggtggcaaggtagccagcgcgcgcatgcgcattgccagcagcggcgag
ctgcgcgaatggatcaccgataccgccggcattgccgactggctggtcgccgacagctac
gaccatgtcggcgatctggccgaaaccctggccttgctgctggacgacccggtcaccgag
gcggccgacctgcccctggcccagtggatcgaacagcgcctactgcccatcgcaaatcag
gacgtggacgtgcgcaaggcctgcatcgtgcaggcatggcgcagcctggccttcgacgag
cgtctggcattcaacaagctgctgaccggcgcgctgcgcgtgggcgtgtcgcagcgactc
gtgcagcaggcgctggccgaattgtcgggcgtggatatcgcgcgcatcgcgcagcgcatg
ctcggcagttggcggccgcatccaacctatcttgcagagctgttgaccagcgaagagctg
cctggcgatcgccagcagccttacccgttcttcctggcatcgccgctggaggcggaggtc
gagacgctgggcgccatcgatgactggctgctggaatggaaatgggacggcattcgcctg
caactgattcgccgcgccggcgaagcggcgctgtggtcgcgcggcgaagaacgtctggat
ggacgttttcctgaaatcgaacacgccgcaatgcaattgccggacggcaccgtcatcgat
ggcgagctgctggcctggcaacccgaacagcccctgccaatgccgtttaccgcgttgcag
acgcgcatccagcggctcaagcccgggcccaagaccttagccgccgcaccggcgcgcgtg
gtggcctacgacctactggaattggcaggcgaagacctgcgcgagcgcccgctacgggag
cggcgcgcactgctggaaggcgtgctcttcgcgctcgcagatccgcgcatcgtcgcctcg
ccgctggtgcaggtcagcgattggcaggccgcagcgcacgtgcgggtggaagcgcgcgaa
cgcggcgtggaagggctgatgctcaagcgcgccagttcgatgtatcagtccggtcgccgt
cgcggcgactggtggaaatggaagatcgacccgctaaccatcgacgcggtgctgttgtac
gcgcaagccggccacggccgacgcagcacgctctacaccgactacaccttcgggctgtgg
catgagggccaactggtgccgatcgccaaggcgtattcgggcctggacgacaaggaaatc
ctgcagctggatcgctggatccgcgccaacaccaccgagcgcttcggcccggtgcgcgcg
gtcacggcgcatcatgtattcgagctggggtttgaagcggtgaaccgcagcgcgcggcac
aaatccggcatcgcagtgcgcttcccgcgcatcctgcgctggcgtcacgacaagccgatg
gccgaagccgatcatctgagcaccctgcaggcactggcgcggtga

DBGET integrated database retrieval system