KEGG   Xanthomonas citri pv. citri 306: XAC1341Help
Entry
XAC1341           CDS       T00084                                 

Gene name
lig2
Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac03030  DNA replication
xac03410  Base excision repair
xac03420  Nucleotide excision repair
xac03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:xac00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    XAC1341 (lig2)
   03410 Base excision repair
    XAC1341 (lig2)
   03420 Nucleotide excision repair
    XAC1341 (lig2)
   03430 Mismatch repair
    XAC1341 (lig2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xac03032]
    XAC1341 (lig2)
   03400 DNA repair and recombination proteins [BR:xac03400]
    XAC1341 (lig2)
Enzymes [BR:xac01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     XAC1341 (lig2)
    6.5.1.6  DNA ligase (ATP or NAD+)
     XAC1341 (lig2)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     XAC1341 (lig2)
DNA replication proteins [BR:xac03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    XAC1341 (lig2)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     XAC1341 (lig2)
DNA repair and recombination proteins [BR:xac03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     XAC1341 (lig2)
   NER (nucleotide excision repair)
    Other NER factors
     XAC1341 (lig2)
   MMR (mismatch exicision repair)
    Other MMR factors
     XAC1341 (lig2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AAM36212
UniProt: Q8PMT5
LinkDB All DBs
Position
complement(1547457..1549061)
Genome map
AA seq 534 aa AA seqDB search
MKRFAALYRTLDRATGTLDKRAALVAYFRDAPALDAAWALYLLAGGKVASARMRIASSGE
LREWITDTAGIADWLVADSYDHVGDLAETLALLLDDPVTEAADLPLAQWIEQRLLPIANQ
DVDVRKACIVQAWRSLAFDERLAFNKLLTGALRVGVSQRLVQQALAELSGVDIARIAQRM
LGSWRPHPTYLAELLTSEELPGDRQQPYPFFLASPLEAEVETLGAIDDWLLEWKWDGIRL
QLIRRAGEAALWSRGEERLDGRFPEIEHAAMQLPDGTVIDGELLAWQPEQPLPMPFTALQ
TRIQRLKPGPKTLAAAPARVVAYDLLELAGEDLRERPLRERRALLEGVLFALADPRIVAS
PLVQVSDWQAAAHVRVEARERGVEGLMLKRASSMYQSGRRRGDWWKWKIDPLTIDAVLLY
AQAGHGRRSTLYTDYTFGLWHEGQLVPIAKAYSGLDDKEILQLDRWIRANTTERFGPVRA
VTAHHVFELGFEAVNRSARHKSGIAVRFPRILRWRHDKPMAEADHLSTLQALAR
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgtttcgcggcgttgtaccgcaccctggatcgcgccaccggtacgctcgacaag
cgcgcggcactggtcgcgtatttccgcgatgcacccgcgctggacgcggcatgggcgctg
tacctgctggccggtggcaaggtagccagcgcgcgcatgcgcattgccagcagcggcgag
ctgcgcgaatggatcaccgataccgccggcattgccgactggctggtcgccgacagctac
gaccatgtcggcgatctggccgaaaccctggccttgctgctggacgacccggtcaccgag
gcggccgacctgcccctggcccagtggatcgaacagcgcctactgcccatcgcaaatcag
gacgtggacgtgcgcaaggcctgcatcgtgcaggcatggcgcagcctggccttcgacgag
cgtctggcattcaacaagctgctgaccggcgcgctgcgcgtgggcgtgtcgcagcgactc
gtgcagcaggcgctggccgaattgtcgggcgtggatatcgcgcgcatcgcgcagcgcatg
ctcggcagttggcggccgcatccaacctatcttgcagagctgttgaccagcgaagagctg
cctggcgatcgccagcagccttacccgttcttcctggcatcgccgctggaggcggaggtc
gagacgctgggcgccatcgatgactggctgctggaatggaaatgggacggcattcgcctg
caactgattcgccgcgccggcgaagcggcgctgtggtcgcgcggcgaagaacgtctggat
ggacgttttcctgaaatcgaacacgccgcaatgcaattgccggacggcaccgtcatcgat
ggcgagctgctggcctggcaacccgaacagcccctgccaatgccgtttaccgcgttgcag
acgcgcatccagcggctcaagcccgggcccaagaccttagccgccgcaccggcgcgcgtg
gtggcctacgacctactggaattggcaggcgaagacctgcgcgagcgcccgctacgggag
cggcgcgcactgctggaaggcgtgctcttcgcgctcgcagatccgcgcatcgtcgcctcg
ccgctggtgcaggtcagcgattggcaggccgcagcgcacgtgcgggtggaagcgcgcgaa
cgcggcgtggaagggctgatgctcaagcgcgccagttcgatgtatcagtccggtcgccgt
cgcggcgactggtggaaatggaagatcgacccgctaaccatcgacgcggtgctgttgtac
gcgcaagccggccacggccgacgcagcacgctctacaccgactacaccttcgggctgtgg
catgagggccaactggtgccgatcgccaaggcgtattcgggcctggacgacaaggaaatc
ctgcagctggatcgctggatccgcgccaacaccaccgagcgcttcggcccggtgcgcgcg
gtcacggcgcatcatgtattcgagctggggtttgaagcggtgaaccgcagcgcgcggcac
aaatccggcatcgcagtgcgcttcccgcgcatcctgcgctggcgtcacgacaagccgatg
gccgaagccgatcatctgagcaccctgcaggcactggcgcggtga

DBGET integrated database retrieval system