KEGG   Xanthomonas citri pv. citri 306: XAC2460Help
Entry
XAC2460           CDS       T00084                                 

Gene name
gstA
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    XAC2460 (gstA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xac02000]
    XAC2460 (gstA)
Enzymes [BR:xac01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     XAC2460 (gstA)
Transporters [BR:xac02000]
 Other Transporters
  Pores ion channels [TC:1]
   XAC2460 (gstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AAM37311
UniProt: Q8PJS0
LinkDB All DBs
Position
2864308..2864952
Genome map
AA seq 214 aa AA seqDB search
MSDDRHVTLFHNPRSRSRGVLVLLEELGARYRLQPIDLEKEQQRTPEFLAINPMGKIPTI
VHGTSVVTEQGAIYQYLAELYPEAGLSPAPGDTDRGAYLRWLAFYGSAFEPAIIDLALKR
SAPPRSLSPYADADTVLQVVDAQLAKGDYLLGERCSAADVLWGGALAWMVEFGLIDPPAP
TRAYIARMVARPAVARAEAVDAGRAPADGASASG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgaccgccacgtcaccctcttccacaacccccgctcccgctcgcgcggagtg
ctggtcttgctggaagaactgggcgcacgctaccgcctgcagcccatcgatctggaaaag
gagcagcagcgcacgccggaattccttgcgatcaacccgatgggcaagattccaaccatt
gttcatggcaccagcgtggtcaccgaacagggcgccatctatcagtacctggccgagctg
tatccggaagccggtctgtcgccggcgccgggcgataccgaccgtggcgcctacctgcgc
tggcttgcgttctacggctctgccttcgagccggcgatcatcgatcttgcgctcaagcgc
agcgccccgccgcgctcgctctcgccttatgccgacgccgacaccgtgctgcaggtggtg
gatgcgcagctggccaagggcgattacctgctgggcgagcgctgcagtgcggccgatgtg
ctgtggggcggcgccttggcgtggatggtggagtttggcctgatcgatccgcccgccccg
acccgcgcctatatcgcccggatggtcgcgcgcccggcggtggcgcgcgccgaagccgtc
gacgccgggcgcgcgcccgcggacggcgccagcgcaagcgggtaa

DBGET integrated database retrieval system