KEGG   Xanthomonas citri pv. citri 306: XAC2524Help
Entry
XAC2524           CDS       T00084                                 

Definition
(GenBank) ferredoxin
Organism
xac  Xanthomonas citri pv. citri 306
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_7 Fer4_2 Fer4_16 Fer4_9 GF_recep_IV Fer4_4 Fer4_6 Fer4_10 Fer4_21
Motif
Other DBs
NCBI-ProteinID: AAM37375
UniProt: Q8PJK7
LinkDB All DBs
Position
complement(2958179..2958463)
Genome map
AA seq 94 aa AA seqDB search
MSLKINELCVNCDVCEPACPNQAISMGETIYVIDPARCTECVGHFDEAQCVVVCPVECID
PDPAIPETHDQLLAKLMQLQRDHPELYEQEPPAP
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgaaaatcaacgagctctgcgtcaactgcgacgtctgcgagccggcgtgcccg
aatcaggccatttcgatgggcgaaaccatctacgtcatcgatccggcacgttgcaccgag
tgcgtgggccatttcgacgaagcgcagtgcgtggtggtgtgcccggtcgaatgcatcgac
ccggatccggccattccggaaacccatgatcagttgctggccaagctgatgcagttgcag
cgcgatcaccccgaattgtacgaacaggagccccccgccccgtga

DBGET integrated database retrieval system