KEGG   Xanthomonas albilineans: XALC_0459Help
Entry
XALC_0459         CDS       T01160                                 

Gene name
ahpF
Definition
(GenBank) probable alkyl hydroperoxide reductase subunit f protein
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xal  Xanthomonas albilineans
Brite
KEGG Orthology (KO) [BR:xal00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    XALC_0459 (ahpF)
Enzymes [BR:xal01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     XALC_0459 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like DAO Glutaredoxin FAD_binding_3 Thi4 K_oxygenase Thioredoxin_4 FMO-like AlaDh_PNT_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CBA14993
UniProt: D2UBG9
LinkDB All DBs
Position
complement(512949..514538)
Genome map
AA seq 529 aa AA seqDB search
MLDADLKTQLKAYLERVVRPIHIAASVDDGAKSREMLDLLEELVLLSDKITLDVHRDSDE
RTPSFALNSPGQDIHLRFAGLPMGHEFTSLVLALLQVGGYPSKATAELIEQVRHLPGEYR
FETYFSLSCQNCPDVVQALNLAAVLNPNIQHVAIDGALFQEEVETRQIMSVPTVYLNGEV
FDQGRMSLEQIVAKLDTGAAKREAVAIAAKAPFDVLVVGGGPAGAAAAIYAARKGIRTGV
AAERFGGQVLDTMAIENFISVQETEGPKMAAALEQHVRQYNVDIMSLQRAEQLIPAGADG
LVEVKLANGASLKSRTVILSTGARWRQMNVPGEDQYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLVEFDSKLRADDVLQRKLRSLGNVDIIVNAQSTEVLGDG
QKVTGLMYKDRVGDAVHQLALEGIFVQIGLLPNTEWLQGAVALSPRGEIVIDERGQTSQP
GVFAAGDATTVPYKQIIIAMGEGSKAALSAFDHLIRHSAPVAGGIAEAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccgatctgaaaacacagttgaaagcctatctggagcgggtcgtgcggccc
atccatattgccgcgtcggtggacgacggtgccaaatcgcgcgagatgctcgatctgctc
gaagaactggtgctgctctcggacaagatcaccttggatgtgcaccgcgacagcgacgag
cgcacgccctcgttcgcactcaacagccccggtcaggacatccacctgcgcttcgccggg
ctcccgatgggccacgaattcacctcgctggtgctggcgttgctgcaagtcggcggttat
ccgtccaaggccaccgcggagctgatcgagcaggtgcgccacctgcccggcgaataccgt
ttcgaaacctatttctcgctgtcctgccaaaactgtccggacgtcgtgcaggcgctgaac
ctagccgcggtgctgaacccgaacatccagcacgtggccatcgatggcgcgctgttccag
gaggaggtggaaacacggcagatcatgtcggtgcccaccgtctacctcaacggcgaagtg
ttcgaccagggacgtatgagcctggagcaaatcgtcgccaagctcgacaccggcgcggcc
aaacgcgaggcggtggcgatcgcggccaaggcgccattcgacgtgttggtggtcggcggc
ggcccagccggcgcggcggcggcgatctacgccgcacgcaagggcatccgcaccggcgtg
gcagccgagcggttcggcggccaggtgctggacaccatggcaatcgaaaatttcatttcg
gtgcaggaaaccgaaggcccgaagatggccgcggcactggagcagcatgtgcgccagtac
aacgtggacatcatgagcctgcagcgcgccgagcaattgattccggccggggccgacggc
ctggtcgaggtcaaactggccaatggtgcgtcgctgaagagccgcacggtgatcctgtcc
accggcgcgcgctggcggcagatgaacgtgccgggcgaggatcaatatcgcaacaagggc
gtggcctactgcccgcactgcgacggcccgttgttcaagggcaaacgcgtcgcggtgatc
ggcggcggcaactccggcgtggaagcagcaatcgacctggccggcatcgtcagccacgtc
accctggtcgagttcgacagcaagctgcgcgccgacgacgtgctgcagcgcaagctgcgc
agcctgggcaacgtggacatcatcgtcaacgcgcagagcaccgaggtgctcggcgacggt
cagaaggtcaccggcctgatgtacaaagaccgtgtcggcgacgctgtccaccaattggcg
ctggaaggcatcttcgtgcagatcgggttgctgccgaacaccgaatggctgcaaggcgcg
gtcgccttgtcgccacgcggcgaaatcgtgatcgacgagcgcggccaaacctcgcaaccg
ggcgtgttcgccgctggcgacgcgaccacggtaccgtacaagcagatcatcatcgccatg
ggcgaaggctccaaggcggcgctgagcgcgttcgaccatctgattcgccacagcgcgccg
gtcgccggcggcatcgccgaggcggcttga

DBGET integrated database retrieval system