KEGG   Xanthomonas sp. ISO98C4: AC801_07965Help
Entry
AC801_07965       CDS       T06033                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
xan  Xanthomonas sp. ISO98C4
Pathway
xan02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:xan00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AC801_07965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xan02000]
    AC801_07965
Enzymes [BR:xan01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     AC801_07965
Transporters [BR:xan02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    AC801_07965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_15 Rad17 AAA_29 AAA_16 AAA_23 RsgA_GTPase AAA_30 NACHT AAA_25 AAA AAA_5 Adeno_IVa2 AAA_33 ATPase_2 AAA_24
Motif
Other DBs
NCBI-ProteinID: AZU29795
UniProt: A0A3T0FX78
LinkDB All DBs
Position
complement(1860588..1861418)
Genome map
AA seq 276 aa AA seqDB search
MNDLQNAKPMHRIAVPAATGAPTAQAPVKVAARNLDFYYDKYHALKSINIEIPEKRVTAL
IGPSGCGKSTLLRIFNRIYALYPKMEARGEVLLDNENILSPKYPMNRLRSKVGMVFQKPV
PFPMTIFENVAYGIRHHEKLSKADMQNRVEQALRQGALWDEVKDKLGQSALGLSGGQQQR
LCIARAVALRPDVLLLDEPTSALDPISTSRIEQLVEELKRDYTIVIVTHNMQQAARVSDY
TAFMYLGDLIEHDRTETIFSQPSKQQTEDYITGRFG
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatctccaaaacgccaagccgatgcatcgcatcgctgttccggccgccacgggg
gcgccgacggcgcaggcgccggtgaaggtggccgcacgcaatctggatttctattacgac
aagtaccacgcgctcaagagcatcaacatcgagatccccgaaaagcgcgtcaccgcgttg
atcggtccctccggctgcggcaagtcgaccttgctgcgcatcttcaaccgcatctacgcg
ctgtacccgaagatggaagcgcgcggcgaggtcttgctggacaacgaaaacatcctgtcg
ccgaagtacccgatgaaccgcctgcgcagcaaggtgggcatggtgttccagaagccggtg
ccgtttccgatgaccatcttcgaaaacgtggcctacggcatccgccaccacgaaaaactc
tccaaggccgacatgcagaaccgcgtcgagcaggccttgcgtcagggcgcgctatgggac
gaggtgaaggacaagctggggcagagcgcgctggggctgtccggcggccagcagcagcgc
ctgtgcatcgcacgtgcggtggcgctgcgcccggatgtgttgttgctggacgaaccgacg
tccgcgctggacccgatctccaccagccgtatcgagcaactggtggaagagctcaagcgc
gactacaccatcgtgatcgtgacccacaacatgcagcaggccgcccgcgtctccgactac
accgccttcatgtatctgggcgacctgatcgagcacgaccgcaccgaaaccattttttcg
cagccctccaagcagcagaccgaggactacatcaccggccgcttcggttga

DBGET integrated database retrieval system