KEGG   Xanthomonas axonopodis Xac29-1: XAC29_01085Help
Entry
XAC29_01085       CDS       T02500                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
xao  Xanthomonas axonopodis Xac29-1
Brite
Enzymes [BR:xao01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     XAC29_01085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu CHRD Big_3_5
Motif
Other DBs
NCBI-ProteinID: AGH75751
UniProt: M4TQY9
LinkDB All DBs
Position
259287..259934
Genome map
AA seq 215 aa AA seqDB search
MRIVPTTLFLATALVLTACKRDEPAPAEPAPAPQASTPAEAAHGGEHAASMVTEAAATTT
ATAELKPTKGNDVKGTVTFKTVDGALRVTGQLSGLKPNTEHGFHIHEKGDCSAPDGSSAG
GHFNPSQSDHGNISADPHHGGDMPNITADAQGNASIDGPVSSNVNLGKADQFDIAGHAVI
VHADADDYKTQPTGNAGGRLACGVITTDNAQAPAK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattgttccgaccaccttgtttctggccaccgccctggtgctgaccgcgtgcaag
cgcgacgaaccggcgccggccgagccggcacctgcaccgcaggccagcacgccggccgaa
gcggcgcacggtggcgaacacgccgcttccatggtcaccgaagcagcagccaccaccacc
gcaaccgccgagctcaagccgaccaagggtaatgacgtcaaaggcacggtgacgttcaag
accgtcgacggtgcgctgcgtgtcaccggccagctcagcggcctcaagcccaataccgag
cacggcttccacatccacgagaagggcgattgcagcgcaccggacggcagcagcgccggc
ggtcacttcaacccgtcccagtccgatcacggcaatatcagcgccgacccgcaccacggt
ggcgacatgcccaacatcaccgccgacgcgcagggtaacgccagcatcgacggcccggtc
tccagcaacgtcaacctcggcaaggccgaccagttcgatatcgccggccacgcggtgatc
gtgcatgccgatgcagacgactacaaaacccagcccaccggcaacgcgggcggccgcctg
gcctgcggcgtgatcaccactgataacgcgcaggcgccggccaagtaa

DBGET integrated database retrieval system