KEGG   Xanthomonas axonopodis Xac29-1: XAC29_01860Help
Entry
XAC29_01860       CDS       T02500                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
xao  Xanthomonas axonopodis Xac29-1
Pathway
xao00564  Glycerophospholipid metabolism
xao01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xao00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    XAC29_01860 (glpD)
Enzymes [BR:xao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     XAC29_01860 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 Pyr_redox_2 FAD_binding_2 FAD_oxidored 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AGH75906
UniProt: M4TRE4
LinkDB All DBs
Position
complement(430685..432199)
Genome map
AA seq 504 aa AA seqDB search
MGEMYDLLVIGGGINGVGIARDAAGRGLSVCLCEQDDLAAHTSSASTKLIHGGLRYLEQY
EFALVGKALAEREVLLRLAPHIIWPLRFLLPHQPHLRPAWMIRAGLFLYDHLGGSKRSLP
RSRRLSLRTHPVGAPLQESLRTGFVYSDAWVQDARLVVLNAMDAARRGAKIHTRTRCVGA
WRDAGFWYAELEDRQGRRRTVQARALANAAGPWAVSFLDTVASVPHEHALRLVKGSHIVV
PKLFDHDHAYIFQQPDRRIVFAIPYEHDFTLIGTTDVDYEADPAAPKIDAAEVQYLCDAV
NLYFQQQISPADVVWNYSGVRPLLDDAEDNAAEVTRDYQLEVVTEGAPLLNVFGGKLTTY
RKLAEEAVDRLTHALGTRKPAWTARGEALPGGEQRDIASLLERVGRARPWLPAATAQRLV
RNYGTCAEHLLGDAQSLTDLGTHFGADLYQAEVDYLRQHEWAVAADDILWRRSKLGLRID
AAGRQRLEDYLQTQSIRQRDVVSA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagatgtacgatcttctggtaatcggcggcggcatcaacggggtgggcattgcc
cgtgatgcggccgggcgcggtctgtcggtgtgcctgtgcgagcaggacgacctggctgcg
cacaccagcagcgccagcaccaaactcattcacggcggcctgcgctacctggagcagtac
gaattcgccttggtcggcaaagcactggccgagcgcgaagtgttgctgcggctggccccg
cacatcatctggccgttgcgcttcctgctgccccaccaaccgcacctgcgcccggcatgg
atgatccgcgccgggctgttcctgtacgaccatctgggcggcagcaagcgcagcctgccg
cgctcgcgccggctgtcgctgcggacgcacccggtcggtgcgccgctgcaggagtcgctg
cgcaccggcttcgtgtattcggatgcgtgggtgcaggacgcgcgactggtggtgctcaac
gcgatggacgccgccaggcgcggtgccaagatccacacccgcacgcgctgtgtcggtgcc
tggcgcgatgcgggcttctggtatgccgagctcgaagaccgccagggccgccgccgcacc
gtgcaggcgcgtgcgctcgccaatgccgccggcccgtgggcggtgtcgttcctggacacc
gtggcctcggtgccgcacgaacatgcattgcggctggtcaagggcagccacatcgtggtg
cccaagctgttcgatcacgaccatgcgtacatcttccagcaaccggaccggcgcatcgtg
ttcgccatcccctacgagcacgacttcaccttgatcggcaccaccgacgtggactacgaa
gccgaccccgccgcgccgaagatcgatgcggccgaagtgcaatacctgtgcgatgcggtg
aacctgtatttccagcagcagatctcccccgccgatgtggtgtggaattacagcggcgtg
cggccgttgctggacgatgccgaagacaacgcagccgaagtgacccgcgattaccagctg
gaagtggtcaccgagggcgcgccgttgctcaacgtgttcggcggcaagctgaccacctat
cgcaagctcgccgaagaggcagtggaccggcttacccacgcgctgggcacacgcaagcct
gcgtggaccgcgcgtggcgaggcattaccaggcggcgagcagcgcgatatcgccagcctg
ctggaacgcgtcggccgcgcgcgcccctggctaccggcagcgaccgcgcagcggctggtg
cgcaactacggcacctgcgccgaacacctgcttggcgatgcgcagagcctgaccgatctg
ggcacgcacttcggcgcggacctgtatcaggccgaggtggattacctgcgccaacacgaa
tgggcggtggcggccgacgatatcctgtggcggcgcagcaagctcggcctgcggatcgat
gcggccgggcggcagcgcctggaagactatctgcagacgcagtcgatccggcaacgcgac
gtcgtttctgcttga

DBGET integrated database retrieval system