KEGG   Xanthomonas axonopodis Xac29-1: XAC29_04065Help
Entry
XAC29_04065       CDS       T02500                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
xao  Xanthomonas axonopodis Xac29-1
Pathway
xao00500  Starch and sucrose metabolism
xao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XAC29_04065
Enzymes [BR:xao01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     XAC29_04065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: AGH76339
UniProt: M4TQV6
LinkDB All DBs
Position
complement(951170..952540)
Genome map
AA seq 456 aa AA seqDB search
MLTALVLLVTTANAQADVILHAFNWPYATVEARAKQIADAGYRKVLVAPAYRSEGSAWWA
RYQPQDIRLIDNPLGDTAAFKKMVQALASNGVETYADIVFNHMANEAATRSDLNYPGGAV
LSQYAANPGRYDSLRLFGTLQSNFLSASDFGPAQCISNYNDAYQVRNYRICGGGSDPGLP
DLLGNDWVVQQQRAYLQALKSMGVTGFRVDAAKHMTFDHLNRVFDAGIRSGVYVFGEVIT
GGGTGNGDYDQFLAPYLQSTPHAAYDFPLFNAVRNAFAIGASMQQLVDPAASGQALPGNR
AVTFAVTHDIPNNAGFRYAILDPVDETLAYAYLIGRNGGMPMLYTDNNESGDNRWVNAYL
RDDLRRMIGFHNGVQGTDMQVLSSSSCHILFRRGSLGIVGINKCGNPVTTTVGMNNSVLY
WNADYVDALGSGNVVRISSSSYTFTLPARGARMWRR
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
ttgctgactgcattggtcctgctggtgaccaccgccaacgcgcaggccgatgtcatcctg
cacgccttcaactggccgtatgccaccgtggaagcgcgcgccaagcagattgccgatgcc
ggctatcgcaaggtattggtcgcccccgcgtaccgctccgaaggaagtgcctggtgggcg
cgctatcaaccccaggacatccgcctgatcgacaatccgctcggcgacaccgctgcattc
aagaagatggtccaggcgctggccagcaacggcgtggaaacctatgccgacatcgtgttc
aaccacatggccaacgaagcggccacacgctcggacctcaattacccaggcggcgcggtc
ctgtcgcagtacgcggcaaaccccggccgttacgattcgctgcgcttgttcggcacgctg
cagtcaaacttcctcagcgccagcgatttcggcccggcgcagtgcatcagcaactacaac
gacgcttaccaggtgcgcaattaccgtatctgcggcggcggcagcgatccaggcctgccg
gatttgctgggcaacgactgggtggtacagcagcagcgcgcctatctgcaggcgctcaag
agcatgggcgtgaccggcttccgggtggatgcggccaagcacatgacgttcgaccatctc
aatcgcgtcttcgatgccggcatccgatcgggtgtgtatgtcttcggcgaagtgatcacc
ggcggcggtacgggcaatggcgattacgaccagttcctggcgccgtacctgcaatccacg
ccgcatgcggcctacgactttccgctgttcaatgcggtgcgcaacgcgttcgccattggc
gccagcatgcagcagctggtggatcccgccgcgtccggacaggcattgccgggcaatcgc
gccgtgacctttgcagtgacccacgacattcccaacaacgccggattccgctatgcgatt
ctcgacccggtggatgaaacgctggcctacgcgtacctgatcggtcgcaacggcggcatg
ccgatgctttataccgacaacaacgaaagcggcgacaatcgctgggtcaacgcttatcta
cgcgacgatctgcgccgcatgatcggcttccataatggcgtgcagggcaccgacatgcag
gtcttgtcgtccagctcctgccacatcctgttccgtcgcggcagcctgggcatcgtgggc
atcaacaagtgcggcaacccggtcaccaccacggtgggaatgaacaacagcgtgttgtac
tggaatgccgattacgtggatgccttgggctcgggcaacgtagtgcgcatttccagtagt
tcctacacctttacgctgccggcgcgcggggcgcgcatgtggcgccgctga

DBGET integrated database retrieval system