KEGG   Xanthomonas axonopodis Xac29-1: XAC29_05900Help
Entry
XAC29_05900       CDS       T02500                                 

Definition
(GenBank) hypothetical protein
  KO
K17758  ADP-dependent NAD(P)H-hydrate dehydratase [EC:4.2.1.136]
Organism
xao  Xanthomonas axonopodis Xac29-1
Brite
KEGG Orthology (KO) [BR:xao00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    XAC29_05900
Enzymes [BR:xao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.136  ADP-dependent NAD(P)H-hydrate dehydratase
     XAC29_05900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carb_kinase Phos_pyr_kin HK
Motif
Other DBs
NCBI-ProteinID: AGH76687
UniProt: M4TV31
LinkDB All DBs
Position
1339766..1340542
Genome map
AA seq 258 aa AA seqDB search
MLVVGGSMRVPGAALLAGEAALRAGAGKLQIATAASVAPAMALAVPEALVLGLGQNGQGE
ITRGHRALDAALAACDAAVIGPGMASTTTATALVKLAAAKAVCPLVLDAGALSRSLRAPP
GRPFVLTPHAGEMATLAGDDKAAVEAAPGEYALAFAQKMRSVVIVKGADSFIAGPDGALW
VHRGGVPGLGTSGSGDTLAGLIAGFAARGSDALTAALWGVFVHAVAGKQLSRRIGTVGFL
AREIPQEVPGILDRLSRK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgttggtggtggggggctcgatgcgcgtgcccggtgcggcattgctggccggggaagct
gcattgcgcgcgggcgccggcaaattgcagatcgccaccgctgccagcgtggcgccggca
atggccctggcggtgcccgaggcattggtgctggggctggggcagaacgggcagggcgag
attacgcgcgggcaccgtgcattggacgcggcgctggcagcctgcgacgcggccgtgatc
gggcctggcatggcgtcgaccacgacggcaacggcgctggtcaagctggccgctgcaaag
gcggtctgtcccttggtgctggacgccggtgcgttgtcgcgcagcttgcgtgcgccgcct
gggcggcccttcgtgctgacgccgcatgcgggggagatggcgaccctcgctggcgacgac
aaggctgcagtggaagcagcgccgggcgagtacgcgctggccttcgcgcagaagatgcgc
agcgtggtgatcgtcaagggggcggacagtttcatcgccgggcctgacggtgcgctatgg
gtgcatcgcggtggtgtgcctgggctgggcacgtcgggctcgggcgataccttggccgga
ttgatcgcaggtttcgctgcgcggggcagcgatgcgttgaccgccgcgctgtggggtgta
tttgtgcacgcggtagcgggtaaacagctgtccaggcggattggcacggttggatttctg
gcacgcgagattccacaagaagtgcccgggattttggatcgtttgtcgcgcaagtga

DBGET integrated database retrieval system