KEGG   Xanthomonas axonopodis Xac29-1: XAC29_12480Help
Entry
XAC29_12480       CDS       T02500                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xao  Xanthomonas axonopodis Xac29-1
Pathway
xao00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xao00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    XAC29_12480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xao02000]
    XAC29_12480
Enzymes [BR:xao01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     XAC29_12480
Transporters [BR:xao02000]
 Other Transporters
  Pores ion channels [TC:1]
   XAC29_12480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AGH77947
UniProt: M4TYP0
LinkDB All DBs
Position
2879904..2880548
Genome map
AA seq 214 aa AA seqDB search
MSDDRHVTLFHNPRSRSRGVLVLLEELGARYRLQPIDLEKEQQRTPEFLAINPMGKIPTI
VHGTSVVTEQGAIYQYLAELYPEAGLSPAPGDTDRGAYLRWLAFYGSAFEPAIIDLALKR
SAPPRSLSPYADADTVLQVVDAQLAKGDYLLGERCSAADVLWGGALAWMVEFGLIDPPAP
TRAYIARMVARPAVARAEAVDAGRAPADGASASG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgaccgccacgtcaccctcttccacaacccccgctcccgctcgcgcggagtg
ctggtcttgctggaagaactgggcgcacgctaccgcctgcagcccatcgatctggaaaag
gagcagcagcgcacgccggaattccttgcgatcaacccgatgggcaagattccaaccatt
gttcatggcaccagcgtggtcaccgaacagggcgccatctatcagtacctggccgagctg
tatccggaagccggtctgtcgccggcgccgggcgataccgaccgtggcgcctacctgcgc
tggcttgcgttctacggctctgccttcgagccggcgatcatcgatcttgcgctcaagcgc
agcgccccgccgcgctcgctctcgccttatgccgacgccgacaccgtgctgcaggtggtg
gatgcgcagctggccaagggcgattacctgctgggcgagcgctgcagtgcggccgatgtg
ctgtggggcggcgccttggcgtggatggtggagtttggcctgatcgatccgcccgccccg
acccgcgcctatatcgcccggatggtcgcgcgcccggcggtggcgcgcgccgaagccgtc
gacgccgggcgcgcgcccgcggacggcgccagcgcaagcgggtaa

DBGET integrated database retrieval system