KEGG   Xanthomonas axonopodis Xac29-1: XAC29_17670Help
Entry
XAC29_17670       CDS       T02500                                 

Definition
(GenBank) bifunctional malic enzyme oxidoreductase/phosphotransacetylase
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
xao  Xanthomonas axonopodis Xac29-1
Pathway
xao00620  Pyruvate metabolism
xao01100  Metabolic pathways
xao01120  Microbial metabolism in diverse environments
xao01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XAC29_17670
Enzymes [BR:xao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     XAC29_17670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M
Motif
Other DBs
NCBI-ProteinID: AGH78945
UniProt: M4UEV8
LinkDB All DBs
Position
complement(4106737..4109046)
Genome map
AA seq 769 aa AA seqDB search
MSTDDFKQAALDYHRQQPAGKIKVTATKPMLTQRDLSLAYSPGVAFACEAIVEDATQASE
LTARGNLVAVITNGTAVLGLGNIGPLASKPVMEGKGVLFQKFAGIDVFDIEINENDPDKL
VDIIASLEPTFGGINLEDIKAPECFIVERKLRERMNIPVFHDDQHGTAIIVGAAVLNALV
VTGKKIEEVKLATTGMGAAGISCVNMLVSLGLKPENILALDRDGVIHTGRTDLDPDKQRY
ARDTDKRTLAEIVEGADIFLGLSAAGILKPEMVASMARQPVIFALANPNPEITPEAAKAV
RPDCIIGTGRSDYPNQINNVLCFPYLFRGALDVGATGINEEMKIACVKAIAAMARREASD
LGAAYGGETPSFGPEYLIPRPLDPRLLVELSSAVAQAAMDSGVATRPITDMEAYRDKLGQ
FVYRTSLMMKPVYDRARADKQRVVYAEGEEEVVLRAVQNVVDEGLAFPILIGRPDVIEAR
IERMGLRLTAGVDFEITNILDDPRFNDYWQYYHALTERRGVTVTAAKELMRSRPTLIAAV
MVARGEADAMLSGVVGRFHKKLGYARSVIPLEPRVSSTSAMTGVINQLGVFFFLDTHVQE
DPTVEQVVEATLQAAYRLKLFGIEPNIALLSHSNFGSHDSRDALKMRQVREALLKRKPEL
NIDGEMQGDTAWDEALRKQIMPNSTLKGRANLFVLPNLEAANIAYNLVRVFTDGVAIGPI
LMGISKPVHILTTSATSRRVMNMTAIAAVDAQIRRQRDAEKAAADKGND
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgacgacttcaaacaggccgccctcgactaccaccgccagcagccggccggc
aagatcaaggtcaccgcgaccaagccgatgctgacccagcgcgatctgtcgctggcgtat
tcgccgggcgtggcgttcgcctgcgaggccatcgtcgaagatgccacccaggccagcgag
ctcaccgcgcgcggcaatctggtggcggtcatcaccaatggcacggcggtgctgggcctg
ggcaacatcggcccgctggcctccaagccggtgatggaaggcaagggcgtgttgttccag
aagttcgccggcatcgacgtgttcgatatcgaaatcaacgagaacgacccggacaagctg
gtggacatcatcgccagcctggagcccaccttcggcggcatcaacctggaagacatcaag
gcgccggaatgcttcatcgtcgagcgcaagctgcgcgagcgcatgaacatcccggtattc
catgacgaccagcacggcaccgcgatcatcgtcggcgccgccgtgctcaacgcgctggtg
gtgaccggcaagaagatcgaagaggtcaagctggccaccaccggcatgggcgcggccggc
atttcctgcgtcaacatgctggtgtcgctgggcctgaagccggagaacatcctggcgctg
gaccgcgatggcgtgatccacaccggccgcaccgatctggatccggacaagcagcgctac
gcccgcgataccgacaagcgcaccctggccgaaatcgtcgaaggcgcggatattttcctc
ggcctgtcggccgccggcatcctcaagccggagatggtcgccagcatggcgcgccagccg
gtgatcttcgcgctggccaaccccaatccggaaatcaccccggaagcggccaaggccgtg
cgcccggattgcatcatcggcaccggtcggtcggactatccgaaccagatcaacaacgtg
ctgtgctttccttacctgttccgcggcgcgttggacgtgggcgccactggcatcaacgaa
gaaatgaagatcgcctgcgtcaaggcgatcgcggcaatggcgcggcgcgaggcctccgac
ctgggcgcggcctatggcggcgagaccccgagcttcggccccgaatatctgattccgcgg
ccgctggacccgcgcctgctggtggagctgtcgtctgcggttgcgcaggcggccatggat
tcgggcgtggccacgcgcccgatcaccgacatggaggcctaccgcgacaagctcggccag
ttcgtctaccgcaccagcctgatgatgaagccggtctacgaccgcgcgcgtgccgacaag
cagcgcgtggtgtatgccgagggcgaagaagaagtggtgctacgcgcggtgcagaacgtg
gtcgacgaaggcctggccttcccgatcctgatcggccgcccggacgtgatcgaagcgcgt
atcgaacgcatgggcctgcgcctgaccgccggcgtggatttcgaaatcaccaacatcctc
gacgaccctcgcttcaacgattactggcagtactaccacgcactcaccgagcgtcgtggc
gtgaccgtcaccgcggccaaggagctgatgcgctcgcgcccgaccttgatcgcggcggtg
atggtggcgcgcggcgaagccgacgcgatgctgtccggcgtggtcggccgcttccacaag
aagctcggttatgcgcgcagcgtgatcccgctggaaccgcgcgtgagctccacctcggcg
atgaccggtgtgatcaaccagcttggcgtgttcttcttcctggatacccatgtgcaggaa
gaccccaccgtcgagcaggtggtggaagcgacgttgcaggcggcgtatcgcctcaagctg
ttcggcatcgagccgaacatcgccttgttgtcgcattccaacttcggcagccacgactcg
cgtgacgcgctgaagatgcgccaggtgcgcgaagcgctgctcaagcgcaagcccgagctc
aacatcgacggcgaaatgcagggcgacaccgcctgggacgaagcgctacgcaagcagatc
atgcccaacagcaccttgaagggtcgtgccaacctgttcgtgttgccgaacctggaagcg
gccaacatcgcctataacctggtgcgcgtgttcaccgacggcgtggcgatcggcccgatc
ctgatgggtatctccaagccggtgcatatcctcaccaccagcgccacctcgcgccgggtg
atgaacatgaccgccatcgccgcggtggacgcacagatccgcagacagcgcgatgcggaa
aaagcggccgccgacaagggcaacgactga

DBGET integrated database retrieval system