KEGG   Xanthomonas arboricola: XB05_21380Help
Entry
XB05_21380        CDS       T06096                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xar  Xanthomonas arboricola
Brite
KEGG Orthology (KO) [BR:xar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    XB05_21380
Enzymes [BR:xar01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     XB05_21380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like AlaDh_PNT_C FAD_binding_3 NAD_binding_7 DAO FMO-like Glutaredoxin Thioredoxin_4 K_oxygenase NAD_binding_8 Spermine_synth Thi4
Motif
Other DBs
NCBI-ProteinID: AKC81009
UniProt: A0A0E3YR28
LinkDB All DBs
Position
complement(5096235..5097827)
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLTAYLERVTRPIQINASIDDSAGSREMLDLLEDLVLLSDKISLDIHRDDNQ
RKPSFALTTPGQDISLRFAGLPMGHEFTSLVLALLQVGGHPSKAAAELIEQVQHLDGDYQ
FETYFSLSCQNCPDVVQALNLAAVLNPRIKHVAIDGAWFQDEGETRQIMSVPTVYLNGEL
FDQGRMTLEQIVAKLDTNAAKRDAAKIAAKDAFEVLVVGGGPAGSAAAVYAARKGIRTGV
AAERFGGQVLDTMSIENFISVPETEGPKMAAALEQHVRQYDVDIMNLQRAEQLIPAGADG
LIEIKLANGASLKSKTVILSTGARWRQMNVPGEEQYKNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLVEFDDKLRADEVLQRKLRSLHNVRIITSAQTTEVLGDG
QKVTGLVYKDRTGGDIQHVDLEGVFVQIGLLPNTEFLKGSVALSPRGEIIVDDRGQTNVP
GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDYLIRSSAPVSADNVAQAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaacctcaagacccagctgaccgcctacctggaacgggttacccgtccg
atccagatcaatgcctcgatcgacgacagcgccggctcgcgcgaaatgctcgacctgctc
gaggatctggtgctgctgtcggacaagatcagcctggacatccaccgcgatgacaaccag
cgcaagccctcgttcgcgctgaccacgccgggccaggacatctcgctgcgctttgccggc
ctgccgatgggccatgagttcacctcgctggtgctggcgctgctgcaggtgggcggtcac
ccgtccaaggccgccgccgagctgatcgagcaggtgcagcacctggatggcgactaccag
ttcgaaacctatttctcgctgtcgtgccagaactgcccggacgtggtgcaggcgctgaat
cttgccgccgtgctcaacccgcgcatcaagcatgtggccatcgacggcgcgtggttccag
gacgagggcgaaacccgccagatcatgtcggtgcccaccgtctacttgaacggcgagctg
ttcgaccagggccgcatgacgctggagcagatcgtcgccaagctcgacaccaacgcggcc
aagcgcgacgccgccaagatcgccgccaaggacgccttcgaggtgctggtggtcggcggt
ggcccggccggttcggcagcggccgtttacgccgcacgcaaaggcatccgcaccggcgtg
gccgccgagcgtttcggtggccaggtgctggacaccatgtcgatcgaaaacttcatctcg
gtgccggaaaccgaaggcccgaagatggccgccgcgctcgagcagcatgtgcgccagtac
gacgtggacatcatgaacctgcagcgcgccgagcagctgattccggccggtgccgatggc
ctgatcgagatcaagctcgccaatggcgcctcgctcaagagcaagaccgtgatcctgtcc
accggcgcgcgctggaggcagatgaacgtgccgggcgaagagcagtacaagaacaagggc
gtggcctattgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaattcgggcgtcgaggcggcgatcgacctggccggtatcgtggcgcatgtc
acgctggtggagttcgacgacaagctgcgcgccgacgaagtgctgcaacgcaagctgcgc
agcctgcacaacgtgcgcatcatcaccagcgcgcagaccaccgaagtgctgggcgatggt
cagaaggtcaccggcctggtctacaaggatcgcaccggcggcgacatccagcacgtagat
ctggaaggcgtgttcgtgcagatcggcctgctgcccaacaccgaattcctcaagggctcg
gtggcgttgtcgccgcgcggcgagatcatcgtcgacgaccgtggccagaccaatgttccg
ggcgtattcgctgccggcgacgccaccacggtgccgtacaagcagatcgtgatcgcgatg
ggcgaaggttccaaggctgcgttgagcgcgttcgattacctgatccgctccagtgcaccg
gtcagcgccgacaacgtcgcccaggcagcataa

DBGET integrated database retrieval system