KEGG   Xanthobacter autotrophicus: Xaut_0052Help
Entry
Xaut_0052         CDS       T00581                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00061  Fatty acid biosynthesis
xau00780  Biotin metabolism
xau01100  Metabolic pathways
xau01130  Biosynthesis of antibiotics
xau01212  Fatty acid metabolism
Module
xau_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:xau00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Xaut_0052
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Xaut_0052
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Xaut_0052
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:xau01004]
    Xaut_0052
Enzymes [BR:xau01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Xaut_0052
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Xaut_0052
Lipid biosynthesis proteins [BR:xau01004]
 Fatty acid synthase
  Component type
   Xaut_0052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ABS65311
UniProt: A7IBB8
LinkDB All DBs
Position
complement(55577..56425)
Genome map
AA seq 282 aa AA seqDB search
MQDLMKGKRGLVMGVANDHSIAWGIAKALAGQGAEIAFTYQGDSVAKRVKPLAESLGSSI
LLPCDVEDLASVDAVFAALKERWGTIDFLVHAVAFSDKSELKGRYADTSRENFSRTMVIS
CFSFTEIAKRAAALMPNGGSLVTLTYGGSTRVMPNYNVMGVAKAALEASVRYLAADYGPA
GIRVNAISAGPVRTLAGAGIADARLMFNYQKRHAPLRRTVSIEEVGGSALYLLSELSGGV
TGEIHFVDSGYNIMSMPHPDVLKQQEDAEAKLAADAPVKAAE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacctgatgaagggcaagcgtggcttggtgatgggggtcgcgaacgaccattcc
atcgcctggggcatcgccaaagccttggccggccagggcgccgagatcgccttcacctac
cagggcgattccgtggccaagcgcgtgaagccgctggccgagagcctcggctcctccatc
ctcctgccgtgcgacgtggaagacctcgccagcgtggatgccgtgttcgcggcgctgaag
gagcgctggggcaccatcgatttcctggtgcatgcggtggccttctccgacaagtcggag
ctgaagggccgctacgctgataccagccgagagaatttctcccgcaccatggtcatctcc
tgcttctccttcacggagatcgccaagcgcgccgccgcgctgatgcccaatggcgggtcg
ctcgtcaccctgacctatggcggctccacccgcgtcatgcccaattacaacgtgatgggc
gtggccaaggcggcgctggaagcttcggtgcgctacctcgccgccgattacgggccggcc
ggcatccgcgtgaacgccatttcggcggggcccgtacgcacgctcgccggcgccggcatc
gctgatgcccgcctgatgttcaactaccagaagcgccacgcccccctgcgccgcaccgtc
tccatcgaggaagtgggcggctccgccctctacctgctgtccgagctgtcgggtggcgtg
acgggcgagatccatttcgtggattccggctacaacatcatgtccatgccgcatcccgac
gtgctcaagcagcaggaagacgccgaggcgaagcttgcggccgacgcgccggtgaaggct
gcggaatag

DBGET integrated database retrieval system