KEGG   Xanthobacter autotrophicus: Xaut_0156Help
Entry
Xaut_0156         CDS       T00581                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00020  Citrate cycle (TCA cycle)
xau00310  Lysine degradation
xau00380  Tryptophan metabolism
xau01100  Metabolic pathways
xau01110  Biosynthesis of secondary metabolites
xau01120  Microbial metabolism in diverse environments
xau01130  Biosynthesis of antibiotics
xau01200  Carbon metabolism
Module
xau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Xaut_0156
  09105 Amino acid metabolism
   00310 Lysine degradation
    Xaut_0156
   00380 Tryptophan metabolism
    Xaut_0156
Enzymes [BR:xau01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Xaut_0156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ABS65415
UniProt: A7IBM2
LinkDB All DBs
Position
151034..153988
Genome map
AA seq 984 aa AA seqDB search
MSRAEQNDVFLSTSFLDGANAAWIEDLYARYEADPNSVSPDWQSFFAALKDDPNAVVQNA
RGASWKKPHWPVHANGELVSAMDGQWIEVEKALSDKVKAKAQKAGVEFSATEVQQATRDS
VKALMMIRAYRMRGHLHANLDPLGLTPPREAPELDPASYGFYEADLDRKIFIDHVLGLEF
ASVRQMVAILRRTYCSSIGVEFMHISSPEEKAWIQERIEGPDKEVTFTREGKRAILNKLV
EAEGFEKFLDVKFTGTKRFGLDGGESLIPALEQIIKRGGNLGVKDIVFGMAHRGRLNVLT
QVMGKPHRALFHEFKGGSWAPDDVEGSGDVKYHLGASSDREFDNNKVHLSLTANPSHLEI
VDPVVLGKARAKQDQLGDTERTKVLPLLLHGDAAFAGQGVVAECLGLSGLKGHRTGGSIH
VIINNQIGFTTNPRYSRSSPYPSDVAKMIEAPIFHCNGDDPESVVFCAKVATEFRQRFHK
PVVIDMFCYRRFGHNEGDEPAFTQPKMYKVIRQHPSVLELYTKKLEAEGVVTSGEVDTMR
AAWRERLEAEHEAGQAYKPNKADWLDGRWAGFKATHEDDDPRRGNTGVAEDTLKAIGEKI
TTVPEGFQVHRTIQRFLDNRRKSIEDGKGIDWATGEALAFSSLLLEGNPVRLSGQDVERG
TFSQRHSVLTDQETEARFKPFNHLSETQAKYEVINSMLSEEAVLGFEYGYTLSEPNTLVL
WEAQFGDFANGAQVLFDQFISSGERKWLRMSGLVCLLPHGYEGQGPEHSSARLERYLQLC
AEDNMQVANVSTPANYFHILRRQMKREFRKPLILMTPKSLLRHKRAVSSLSDMVTGTSFH
RVLWDDAQSHPEENAIKLVPDDKIRRVVLCTGKVYYDLLEEREKRGVSDVYLMRVEQLYP
FPLKTLVQELSRFKNAEVSWCQEEPKNQGSWAFVQPYLEWVLEQVGGAAKRPRYAGRPAS
AATATGLMSKHLAQLKAFLDEALG
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcgcggaacagaacgacgttttcctctccacctccttcctcgacggcgccaat
gccgcctggatcgaggatctctacgcccgctacgaagccgacccgaattcggtcagcccc
gactggcagagcttcttcgcagcgctgaaggatgatccgaacgcggtggtccagaatgcg
cgcggcgcttcctggaagaagccgcactggccggtgcacgccaatggcgagctggtctcg
gccatggatggccagtggatcgaggtggaaaaggccctctcggacaaggtgaaggccaag
gcgcagaaggcgggcgtcgaattctccgccaccgaggtgcagcaggccacccgcgacagc
gtcaaggcgctgatgatgatccgcgcctatcgcatgcgcggccacctgcacgccaatctc
gacccgctcggcctgaccccgccgcgcgaggcaccggagcttgatcctgcctcctacggc
ttctacgaggccgacctcgaccgcaagatcttcatcgaccacgtgctgggcctcgagttc
gcctcggtccgccagatggtggcgatcctgcgccgcacctattgctccagcatcggcgtc
gagttcatgcacatctcctcgcccgaggagaaggcctggatccaggagcgtatcgagggt
cccgacaaggaggtgaccttcacccgcgagggcaagcgcgccatccttaacaagctggtg
gaagccgagggcttcgagaagttcctcgatgtgaagttcaccggcaccaagcgcttcggc
ctcgacggcggcgagagcctgatcccggcgctggaacagatcattaagcgcggcggcaac
ctcggcgtgaaggacatcgtgttcggcatggcccatcgcggccgcctgaacgtgctcacc
caggtgatgggcaagccccaccgcgccctgttccacgagttcaagggcggctcctgggcc
cccgacgacgtggaaggctcgggtgacgtgaagtaccacctgggtgcctcgtccgaccgc
gagttcgacaacaacaaggtccacctgtcgctgaccgccaacccgtcgcatctcgagatc
gtggatccggtggtgctgggcaaggcccgcgccaagcaggaccagctgggcgacaccgag
cggaccaaggtgctgccgctgctgctgcacggcgacgccgccttcgccggccagggcgtg
gtggccgagtgcctcggcctctccggcctgaagggccaccgcaccggcgggtcgatccac
gtcatcatcaacaaccagatcggcttcaccaccaatccgcgctattcgcgctcctcgcct
tatccctctgacgtggcgaagatgatcgaggcgccgatcttccactgcaacggcgacgat
ccggaatcggtggtgttctgcgccaaggtggcgaccgagttccgccagcgcttccacaag
cccgtcgtcatcgacatgttctgctaccgccgcttcggccacaacgagggcgacgagccg
gcgttcacccagccgaagatgtacaaggtgatccgccagcacccgagcgtgctggagctc
tacaccaagaagctcgaagccgagggcgtggttacctccggcgaggtcgacaccatgcgc
gcggcgtggcgcgagcggctggaggccgagcacgaggccggacaggcctacaagcccaac
aaggccgactggctcgacggccgctgggccggcttcaaggccacccatgaggacgacgat
ccgcggcgcggcaacaccggcgtggccgaggacacgctgaaggccatcggcgagaagatt
accaccgtgccggagggcttccaggtccaccgcaccatccagcgcttcctcgacaaccgc
cgcaagtccatcgaggacggcaagggcatcgactgggcgacgggcgaggcgctggccttc
tcgtccctgctgctggaaggcaacccggtgcgcctgtccggccaggatgtggagcgcggc
acgttctcccagcgccattcggtgctgaccgaccaggagacggaggcccgcttcaagccc
ttcaaccatctctccgagacccaggccaagtacgaggtcatcaactcgatgctctcggag
gaggcggtgctcggcttcgagtatggctacaccctgtccgagcccaataccctggtgctc
tgggaggcgcagttcggcgacttcgccaacggcgcgcaggtgctgttcgaccagttcatc
tcctcgggcgagcgcaagtggctgcgcatgtccggcctcgtctgcctgctgccccacggc
tatgagggccaggggccggagcattcctccgcccgcctcgagcgctatctgcagctctgc
gccgaggacaacatgcaggtggccaacgtctccaccccggccaactatttccacatcctg
cgccggcagatgaagcgggagttccgcaagccgctgatcctgatgacgccgaagtcgctg
ctgcgccacaagcgggcggtgtcctcgctgagcgacatggtgaccggcacttcgttccac
cgggtgctctgggacgatgcccagtcccatccggaggaaaacgccatcaagctggtgccg
gacgacaagatccgtcgcgtcgtgctgtgcacgggcaaggtctattacgacctgctcgag
gagcgcgagaagcgcggcgtgtcggacgtctacctgatgcgtgtggagcagctttacccg
ttcccgctcaagaccctggtgcaggaactctcgcgcttcaagaacgccgaggtgtcctgg
tgccaggaagagcccaagaaccagggctcctgggcgttcgtgcagccctatctggaatgg
gtgctggagcaggtgggcggcgccgcgaagcgtccgcgctatgccggtcgtcccgcctcg
gcggcgaccgccaccggcctcatgtcgaagcacctggcccagctcaaggccttcctcgac
gaagccctgggctga

DBGET integrated database retrieval system