KEGG   Xanthobacter autotrophicus: Xaut_0325Help
Entry
Xaut_0325         CDS       T00581                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00473  D-Alanine metabolism
xau00550  Peptidoglycan biosynthesis
xau01100  Metabolic pathways
xau01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:xau00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Xaut_0325
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Xaut_0325
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Xaut_0325
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xau01011]
    Xaut_0325
Enzymes [BR:xau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Xaut_0325
Peptidoglycan biosynthesis and degradation proteins [BR:xau01011]
 Precursor biosynthesis
  Amino acid ligase
   Xaut_0325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 RimK CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABS65583
UniProt: A7IC40
LinkDB All DBs
Position
335585..336505
Genome map
AA seq 306 aa AA seqDB search
MAKHVAVLMGGWSSEREVSLRSGAACAGALEAAGYRVTRVDVGRDVAEVLTHLKPDVAFN
VLHGQPGEDGTIQGILEILRIPYSHSGVLASALAMDKAQARIMLAAAGVPVAKGGLVSRA
EAAKAHIMPTPYVLKPNAGGSSVGVFIVREDQAHPPQELTREDWPHGENLLAEEFIPGLE
LTCAVMGDKVLDVIEIESTQKFYDYESKYAPGGSQHILPARILPEIYQRVQMLSLTAHRA
LGCRGVSRSDFRFDPSRGDGSGLICLEVNTQPGMTETSLVPELAAHAGISFGELVTWMVE
DASLER
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaacacgtggcggtgctcatgggcggctggtcgtcggagcgcgaagtctccctg
cgctccggcgccgcctgcgccggtgcgctggaggcggcaggctaccgggtcacccgcgtg
gacgtgggccgcgacgtggccgaggtgctgacgcacctgaagccggacgtggcgttcaac
gtgctgcacggccagcccggcgaggacggcaccatccagggcatcctcgaaatcctgcgc
atcccctattcccattccggcgtactggcctcggccctcgccatggacaaggcgcaggcg
cgaatcatgctcgccgccgctggtgtcccggtggcgaaaggcggcctcgtctcccgcgcc
gaggcggcaaaggcgcacatcatgcccacgccctacgtgctgaagcccaatgcgggaggg
tccagcgtcggcgtcttcatcgtgcgcgaagaccaggcccatccgccgcaggaattgacc
cgtgaggattggccgcacggagaaaatcttctcgccgaagaatttattcccggcctcgaa
ctcacctgcgcggtgatgggcgacaaggtgctcgacgtgatcgagatcgagtccacacag
aagttttacgattacgaaagcaaatatgcaccgggcggctcgcagcacattcttccggcc
cggattttacccgaaatttaccaacgggtgcagatgttaagcctcacggcgcaccgagct
ctcggatgccggggggtgtcgcggagcgactttcggttcgacccttcgagaggggatggc
tccggcctgatctgcctcgaggtgaacacccagcccgggatgactgagacgtctctggtg
ccggaactggccgcccacgcgggcatctcattcggtgagcttgtgacatggatggtggag
gacgcttcgctggagcgctaa

DBGET integrated database retrieval system