KEGG   Xanthobacter autotrophicus: Xaut_0995Help
Entry
Xaut_0995         CDS       T00581                                 

Definition
(GenBank) protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xau  Xanthobacter autotrophicus
Brite
KEGG Orthology (KO) [BR:xau00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xau01001]
    Xaut_0995
Enzymes [BR:xau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Xaut_0995
Protein kinases [BR:xau01001]
 Serine/threonine kinases: Other
  Bacterial family
   Xaut_0995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Sel1 APH Pkinase_fungal Kdo Kinase-like Seadorna_VP7 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: ABS66246
UniProt: A7IE03
LinkDB All DBs
Position
complement(1112604..1114364)
Genome map
AA seq 586 aa AA seqDB search
MTTATTERIGHYEITALLGSGGNGRVHAARDTMLGREVAIKSLRPELMNDASFLDRFRAE
ASSLARLNHPNIATLYALQPEGSNLYMIMELVRGRTLESVLQQRGGPLPVQECLAIVAQV
ADGLAYAHSMGVIHRDIKPSNLMITDDGRVKIMDFGIARVAGSQRLTRDGSIIGTLAYIA
PEQLRGSPGDERSDLYSLAIVVYEMLSGAPPFAADTDYDLIQAHVNTKPQRLIPKVPGLS
VKAEGAILQALAKKPEQRFPTVRAFSDALGATSLRAEATGVIQNYTRLISNTSGGASNTI
APHPLPAPGPIGRLRTALDAAWRRFKAMPIELRGLAVGGVAAIAVAGVVVAESFRGPTPV
TAPRTDTARGAAERRGPTGNAATGNAATGATASNTARIENMYFDRNTRPSATAATTTTEA
RVATAPPAMTSAELRTAMSEAMERRDYGRAYELASRLAETGNAEALYTLGFLLEKGEGVG
QSFVSAAYKYRQAAEKDLAKAQWRLGNLYYTGKGFGAPDYKEARAWYLKAAQQGIAEAQY
NLGVIFENGQGIDPDRNAARYWYDLAAAQGYARARQALEALGGPAK
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggcgaccaccgaacgcatcggccattacgaaatcacagcgctgctcggatcg
ggcggtaatggccgcgtccatgccgcccgcgacaccatgctgggccgcgaggtggccatc
aagtcgctgcgccccgagctgatgaacgacgcgagcttcctcgatcgcttccgcgccgag
gccagcagcctcgcccggctcaaccatcccaatatcgcgacgctctacgccctccagccg
gagggcagcaacctctacatgatcatggagctggtgcgcgggcgcacgctggagagcgtg
ctccagcagcgcggtggtccgcttccggttcaggaatgcctcgccatcgtggcacaggtg
gcggacggcctcgcctatgcccattccatgggcgtgatccatcgcgacatcaagccgtcc
aacctcatgatcaccgacgacggccgggtgaagatcatggatttcggcatcgcccgggtg
gccggcagccagcggctgacacgcgacggctccatcatcggcaccctggcctatatcgcg
ccggagcaattgcggggcagccccggcgacgagcgctccgacctctacagcctggccatc
gtggtctacgaaatgctctccggcgccccgccgttcgcggcggacaccgactacgacctg
atccaggcccatgtgaacaccaagccgcagcgcctcatccccaaggtccccggcctgtcg
gtgaaggccgaaggcgccatcctgcaggcccttgccaagaagccggaacagcgcttcccc
accgtccgggcgttcagcgacgcgctcggcgcgaccagcctgcgcgccgaggccaccggg
gtgatccagaactatacgcgcctcatctccaacacctctggcggcgcctcgaacaccatc
gcgccccatccgcttcccgcgcccggccccatcggccgcctgcggacggcgctcgacgcc
gcatggcggcgcttcaaggccatgccgatcgagctgcgcgggctcgcggtcggcggcgtg
gcggcgatcgcggtggcgggcgtggtggtggcggagagtttccgtggccccacgccggtc
accgccccccgcaccgatacggcgcgcggggccgccgagcggcgtggccccaccggcaac
gcggccacgggcaacgcggcgaccggcgccaccgccagcaataccgcgcggatcgagaac
atgtatttcgatcgcaacacgcgaccttcggccaccgctgcgaccaccaccacggaagcc
agggtcgccacggcgccgccggccatgacctccgccgaactgcgcaccgccatgagcgag
gccatggagcgccgcgactacggccgggcctatgagctggcctcccgcctcgccgagacc
ggcaatgcggaggcgctgtacaccctcggcttcctgctggagaagggcgagggcgtcggc
cagagcttcgtttccgccgcctacaagtaccggcaggcggcggaaaaggacctggcgaaa
gcccaatggcgcctcggcaatctctactataccggaaagggcttcggcgcccccgactac
aaggaggcgcgggcctggtatctcaaggccgcgcagcagggcatcgcggaagcgcaatac
aatctcggcgtgatcttcgagaacggccagggcatcgatcccgaccgcaatgccgcccgg
tattggtacgatctcgccgcagcccagggctatgcccgcgcccggcaggcgctcgaagct
ttgggcggtcccgccaaatga

DBGET integrated database retrieval system