KEGG   Xanthobacter autotrophicus: Xaut_1918Help
Entry
Xaut_1918         CDS       T00581                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00630  Glyoxylate and dicarboxylate metabolism
xau00710  Carbon fixation in photosynthetic organisms
xau01100  Metabolic pathways
xau01120  Microbial metabolism in diverse environments
xau01200  Carbon metabolism
Module
xau_M00165  Reductive pentose phosphate cycle (Calvin cycle)
xau_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Xaut_1918
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Xaut_1918
Enzymes [BR:xau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Xaut_1918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ABS67163
UniProt: A7IGM0
LinkDB All DBs
Position
complement(2169093..2170559)
Genome map
AA seq 488 aa AA seqDB search
MGADAAIGQIKDAKKRYAAGVLKYAQMGYWDGDYQPKDTDVLALFRITPQDGVDAVEAAA
AVAGESSTATWTVVWTDRLTAADMYRAKAYKVEPVPGQPGQYFCWVAYDLDLFEEGSIAN
LTASIIGNVFSFKPLKACRLEDMRLPVAYVKTFRGPPTGIVVERERLDKFGRPLLGATTK
PKLGLSGKNYGRVVYEGLKGGLDFVKDDENINSQPFMHWRDRFLYCMEAVNKAQAETGEV
KGHYLNITAGTMEEMYRRAEFAKELGSVVVMVDLIVGWTAIQSISNWCRENDVLLHMHRA
GHGTYTRQKGHGISFRVIAKWLRLAGVDHLHTGTAVGKLEGDPMTVQGYYNVCRETVTKT
DYTRGIFFDQDWAGLRKVMPVASGGIHAGQMHQLIDLFGEDVVLQFGGGTIGHPDGIQAG
AIANRVALETMILARNEGRDIKNEGPEILIEAAKWCRPLRAALDTWGEVTFNYASTDTSD
FVPTASVA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccgacgccgccatcgggcagatcaaggacgccaagaagaggtacgccgccggc
gtactcaaatatgcccagatgggctattgggacggcgactaccagccgaaggacaccgat
gtcctggccctgttccgcatcacgccgcaggacggcgtggacgcggtggaagccgctgcg
gcggtggcgggcgaaagctccaccgccacctggaccgtggtgtggaccgaccgcctcacc
gccgccgacatgtaccgcgccaaggcctacaaggtggagccggtgccgggccagccgggc
cagtatttctgctgggtcgcctacgacctcgacctgttcgaggaaggctccatcgccaac
ctgaccgcgtcgatcatcggcaacgtcttctcgttcaagccgctcaaggcctgccgcctg
gaggacatgcgcctgccggtggcctatgtgaagaccttccgcggcccgcctaccggcatc
gtggtggagcgcgagcgcctcgacaagttcggccggccgctgctcggcgccactaccaag
cccaagctcggcctctccggcaagaactacggccgcgtggtctatgaggggctcaagggc
ggcctcgacttcgtgaaggacgacgagaacatcaactcgcagcccttcatgcactggcgc
gaccgcttcctctactgcatggaggccgtcaacaaggcccaggccgagaccggcgaggtg
aaggggcactacctcaacatcaccgccggcaccatggaagagatgtaccgccgcgccgag
ttcgccaaggagctgggctccgtggtggtgatggtggatctcatcgtgggctggaccgcg
atccagtccatctccaactggtgccgcgagaacgacgtgctgctgcacatgcaccgcgcc
ggccatggcacctacacgcgccagaagggccacggcatctcgttccgcgtcatcgccaag
tggctgcgcctcgccggcgtcgaccatctccacacaggcaccgcggtgggcaagctggaa
ggcgaccccatgaccgtgcagggctactacaacgtctgccgcgagaccgtgaccaagacc
gactacacccgcggcatcttcttcgaccaggactgggccggcctgcgcaaggtgatgccg
gtggcctccggtggcatccatgccggccagatgcaccagctcatcgacctgttcggcgag
gacgtggtgctgcagttcggcggcggcaccatcggccatcccgatggcatccaggccggc
gccatcgccaaccgcgtcgcgctggaaaccatgatcctcgcccgcaacgagggccgggac
atcaagaacgagggtcccgaaatcctcatcgaggccgccaagtggtgccgtccgctgcgc
gccgccctcgatacctggggcgaggtgaccttcaactacgcctccaccgacacttccgac
ttcgttcccaccgcgtccgtggcctga

DBGET integrated database retrieval system